last update : january 2015

Public data retrieved in 2014



Home

AT5G04140 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT5G04140
Master Protein AT5G04140.1
Description (curated) GLS1/GLU1/GLUS (FERREDOXIN-DEPENDENT GLUTAMATE SYNTHASE 1); glutamate synthase (ferredoxin)
Calculated MW (PPDB) 176.75
Calculated PI (PPDB) 5.93
Length 1,622
Curated Annotation
Description (curated) GLTB1 (Fd-GOGAT1) Ferredoxin-dependent glutamate synthase 1, chloroplast precursor (EC 1.4.7.1)/
Function (curated) metabolism carbon
Localization (curated) Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
VAQGAKPGEGGQLPGK 1,492.79970 0.17 71.9 36
INREIVK 870.52866 0.16 36.1 3
DALIALGCMEHR 1,327.63763 0.43 58.6 2
TVKICNVDR 1,094.53897 0.22 50.1 2
KQEVHTNGPVLDDDILADPLVIDAIENEKVVEK 3,654.89912 0.50 55.1 1
NHPTLSVK 894.49229 0.18 29.9 1
IPTVTIEQAQK 1,226.68703 0.30 81.3 74
GVEGSLQK 816.43408 0.16 50.5 13
PGGEYHSNNPEMSK 1,577.64159 0.13 39.9 1
NGKIPTVTIEQAQK 1,525.84636 0.26 29.3 1
LGPGMMIAVDLVNGQVYENTEVK 2,476.23407 0.59 50.6 2
TSTGEVTFQSA 1,126.51421 0.31 50.2 6
FCTGGMSLGAISR 1,362.59073 0.36 28.3 1
GQMEAWDGPALLLFSDGK 1,965.91417 0.56 83.8 3
PGGEYHSNNPEMSK 1,545.65175 0.14 48.1 1
SEALGLFYLDLQNELYESPFAIYHR 2,987.47043 0.64 93.2 6
APIPVGKVEPAVAIVQR 1,743.04060 0.34 44.4 2
GSDSANLDSAAEIMIR 1,648.77260 0.44 71.2 3
ISGLTFDELAR 1,220.64006 0.42 92.9 58
TPEEALMILVPEAYK 1,734.87494 0.52 72.3 6
IAKEDSTDDIER 1,390.65758 0.18 86.4 46
GSDSANLDSAAEIMIR 1,664.76752 0.35 91.4 1
ETHEAIAIAMNR 1,386.65613 0.24 90.5 59
GSDSANLDSAAEIMIR 1,680.76244 0.36 101.1 6
LVAEAGIGTVASGVAK 1,441.81395 0.34 145.2 68
ETMPNIQQVFVK 1,432.73839 0.44 76.2 4
LIGESNDYVGK 1,193.59276 0.27 73.7 49
ETMPNIQQVFVK 1,448.73331 0.36 42.2 2
TPEEALMILVPEAYK 1,718.88002 0.50 88.7 7
FLKPVNFK 991.58543 0.29 44.7 16
RYSTNTSPR 1,080.53120 0.10 42.4 8
EGLVMSLEVNIGK 1,403.73294 0.42 41.4 1
VAGVIAK 656.42206 0.17 31.1 2
VAQGAKPGEGGQLPGKK 1,620.89465 0.15 94.9 60
SSTVMENEEILR 1,422.66602 0.29 84 11
ISSFNPYGK 1,011.50250 0.29 41.5 13
LHTGVGMIFLPQDDTFMQEAK 2,441.12425 0.43 49 4
NVAAGMTGGLAYLLDEDDTLLPK 2,408.17804 0.56 141.2 9
LEPTRPSIPIMLAVGAVHQHLIQNGLR 2,991.64395 0.45 43.1 1
EGLVMSLEVNIGKR 1,575.82896 0.40 41.7 1
LEPTRPSIPIMLAVGAVHQHLIQNGLR 2,959.65411 0.54 36.2 2
YSTNTSPR 924.43010 0.14 39 3
TQHLDLSYLLSSVGTPSLSSTEIR 2,603.34422 0.54 66.8 13
APIPVGK 680.42207 0.18 31.7 13
YPEVVDFYDYYK 1,599.71327 0.49 83.7 21
GILAQLGYNSLDDIIGR 1,816.96825 0.56 132.5 20
VSAYIAR 778.43370 0.21 51.1 15
VLSTYFDIR 1,112.58658 0.41 50.4 14
FLGHNGEINTIQGNLNWMQSR 2,428.17053 0.48 49.1 2
EGLVMSLEVNIGK 1,419.72786 0.43 46.6 1
GQMEAWDGPALLLFSDGK 1,933.92433 0.61 105.3 4
TSDNFVYVASEVGVVPVDEAK 2,224.08984 0.47 85.8 9
SQQAFGYSSEDVQMVIESMASQGK 2,606.16278 0.59 45.5 1
ETHEAIAIAMNR 1,370.66121 0.22 61.3 9
GMAGGEIVVTPVEK 1,417.71220 0.30 127.5 54
FPGVPGDLVNYFLYVAEEVR 2,283.15746 0.72 103 4
LHTGVGMIFLPQDDTFMQEAK 2,377.14458 0.49 35.7 1
FGVTPTFLVNADQLEIK 1,891.00905 0.52 96.5 26
EDSTDDIER 1,078.44145 0.17 58 40
GNADIIQISGHDGGTGASPISSIK 2,294.15018 0.37 91 11
YLPLFWQLVPPSEEDTPEASAAYVR 2,877.42244 0.61 31.9 1
SETAYAVYQQHLSNRPVNVLR 2,444.25598 0.36 59.8 4
KGVEGSLQK 944.52904 0.13 52.5 8
EDSTDDIERELYICR 1,903.81052 0.42 31 1
ETHEAIAIAMNR 1,354.66629 0.31 63.7 3
FCTGGMSLGAISR 1,378.58565 0.39 87.4 30
TPEEALMILVPEAYK 1,702.88510 0.57 112.7 4
FAQVTNPAIDPLREGLVMSLEVNIGK 2,842.48978 0.53 74.4 3
PGEGGQLPGKK 1,066.57704 0.12 54 4
SNSGEGGEDPIR 1,216.53195 0.19 79.5 23
GNILELGPENASQVILSNPVLNEGALEELMKDQYLKPK 4,195.17209 0.57 51.7 9
PGEGGQLPGK 938.48209 0.15 51.1 3
ALYYLCEAADDAVR 1,619.71368 0.46 41 1
NGLRPAR 782.45108 0.10 23.4 2
EQSLAPFDK 1,033.50800 0.30 40.8 4
ETMPNIQQVFVK 1,464.72823 0.38 79.7 55
VTAPAGELQLK 1,125.63933 0.31 92.4 100
FAQVTNPAIDPLR 1,440.77248 0.38 94.7 38
SGSQLLVLSDRSDR 1,531.79540 0.29 36.6 1
VEPAVAIVQR 1,080.62909 0.29 88.8 94
GMAGGEIVVTPVEK 1,401.71728 0.28 100.9 8
ETLSFWVK 1,008.52800 0.42 40.7 3
AVNAGLLK 784.48064 0.25 60.4 24
EGLQVLGWR 1,056.57158 0.44 46.9 7
EKSETAYAVYQQHLSNRPVNVLR 2,701.39352 0.32 71.5 3
WKPLTDVVDGYSPTLPHLK 2,165.15205 0.44 46.7 3
SGSQLLVLSDR 1,173.63532 0.35 83.5 78
LGPGMMIAVDLVNGQVYENTEVK 2,540.21374 0.49 56.5 1
LENFGFIQFR 1,269.65054 0.49 53.5 3
RLENFGFIQFR 1,425.75165 0.43 56.7 2
SLIEAHVEK 1,024.55527 0.22 47.1 36
SDRAPIPVGK 1,038.58215 0.19 42.8 1
GMAGGEIVVTPVEK 1,385.72237 0.34 46.7 3
ISGLTFDELARETLSFWVK 2,211.15750 0.70 49.6 1
ICHTNNCPVGVASQR 1,693.71477 0.28 83.2 18
HAGGPWELGLTETHQTLIANGLR 2,470.27164 0.47 88.2 2
GLQNGDIATSAIK 1,286.68298 0.30 99.7 43
ALYYLCEAADDAVR 1,571.72894 0.49 75.7 2
DALIALGCMEHR 1,407.61221 0.36 65.7 12
EVPVNVPIVGK 1,149.67569 0.35 72.5 94
SSTVMENEEILR 1,438.66093 0.29 100.4 68
AFSEDTTKR 1,053.50906 0.14 59.9 25
QVIENIFEK 1,118.59712 0.38 48 23
ICHTNNCPVGVASQREELR 2,220.98511 0.31 63.9 1
ENEIRPFGNPR 1,327.66324 0.26 40.1 16
ICNVDRAACGR 1,272.51863 0.20 41.1 1
DLLEFKSDR 1,121.57166 0.33 51.7 5
AFSEDTTK 897.40796 0.16 50.3 5
SGVDVLMAAAMGADEYGFGSLAMIATGCVMAR 3,340.39125 0.70 91.2 5
TELLRPR 883.52393 0.20 32.8 18
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 3.97 1.09 94.93 1,626 STR
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 0 1 -