last update : january 2015

Public data retrieved in 2014



Home

AT5G04140 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT5G04140
Master Protein AT5G04140.1
Description (curated) GLS1/GLU1/GLUS (FERREDOXIN-DEPENDENT GLUTAMATE SYNTHASE 1); glutamate synthase (ferredoxin)
Calculated MW (PPDB) 176.75
Calculated PI (PPDB) 5.93
Length 1,622
Curated Annotation
Description (curated) GLTB1 (Fd-GOGAT1) Ferredoxin-dependent glutamate synthase 1, chloroplast precursor (EC 1.4.7.1)/
Function (curated) metabolism carbon
Localization (curated) Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
GLQNGDIATSAIK 1,286.68298 0.30 99.7 43
ETLSFWVK 1,008.52800 0.42 40.7 3
GSDSANLDSAAEIMIR 1,680.76244 0.36 101.1 6
ETMPNIQQVFVK 1,448.73331 0.36 42.2 2
TELLRPR 883.52393 0.20 32.8 18
PGEGGQLPGK 938.48209 0.15 51.1 3
GMAGGEIVVTPVEK 1,401.71728 0.28 100.9 8
TPEEALMILVPEAYK 1,702.88510 0.57 112.7 4
GSDSANLDSAAEIMIR 1,648.77260 0.44 71.2 3
NVAAGMTGGLAYLLDEDDTLLPK 2,408.17804 0.56 141.2 9
APIPVGK 680.42207 0.18 31.7 13
DALIALGCMEHR 1,407.61221 0.36 65.7 12
EVPVNVPIVGK 1,149.67569 0.35 72.5 94
GQMEAWDGPALLLFSDGK 1,933.92433 0.61 105.3 4
GNILELGPENASQVILSNPVLNEGALEELMKDQYLKPK 4,195.17209 0.57 51.7 9
SGSQLLVLSDR 1,173.63532 0.35 83.5 78
VAQGAKPGEGGQLPGK 1,492.79970 0.17 71.9 36
AFSEDTTKR 1,053.50906 0.14 59.9 25
VTAPAGELQLK 1,125.63933 0.31 92.4 100
EQSLAPFDK 1,033.50800 0.30 40.8 4
FAQVTNPAIDPLR 1,440.77248 0.38 94.7 38
VSAYIAR 778.43370 0.21 51.1 15
APIPVGKVEPAVAIVQR 1,743.04060 0.34 44.4 2
GSDSANLDSAAEIMIR 1,664.76752 0.35 91.4 1
GQMEAWDGPALLLFSDGK 1,965.91417 0.56 83.8 3
LHTGVGMIFLPQDDTFMQEAK 2,441.12425 0.43 49 4
VAQGAKPGEGGQLPGKK 1,620.89465 0.15 94.9 60
IPTVTIEQAQK 1,226.68703 0.30 81.3 74
FPGVPGDLVNYFLYVAEEVR 2,283.15746 0.72 103 4
SEALGLFYLDLQNELYESPFAIYHR 2,987.47043 0.64 93.2 6
PGGEYHSNNPEMSK 1,577.64159 0.13 39.9 1
GVEGSLQK 816.43408 0.16 50.5 13
LEPTRPSIPIMLAVGAVHQHLIQNGLR 2,959.65411 0.54 36.2 2
SETAYAVYQQHLSNRPVNVLR 2,444.25598 0.36 59.8 4
LVAEAGIGTVASGVAK 1,441.81395 0.34 145.2 68
ICNVDRAACGR 1,272.51863 0.20 41.1 1
YLPLFWQLVPPSEEDTPEASAAYVR 2,877.42244 0.61 31.9 1
NGKIPTVTIEQAQK 1,525.84636 0.26 29.3 1
EDSTDDIER 1,078.44145 0.17 58 40
KGVEGSLQK 944.52904 0.13 52.5 8
IAKEDSTDDIER 1,390.65758 0.18 86.4 46
ALYYLCEAADDAVR 1,619.71368 0.46 41 1
ETHEAIAIAMNR 1,370.66121 0.22 61.3 9
LGPGMMIAVDLVNGQVYENTEVK 2,540.21374 0.49 56.5 1
TVKICNVDR 1,094.53897 0.22 50.1 2
NHPTLSVK 894.49229 0.18 29.9 1
LEPTRPSIPIMLAVGAVHQHLIQNGLR 2,991.64395 0.45 43.1 1
QVIENIFEK 1,118.59712 0.38 48 23
EDSTDDIERELYICR 1,903.81052 0.42 31 1
NGLRPAR 782.45108 0.10 23.4 2
TPEEALMILVPEAYK 1,718.88002 0.50 88.7 7
EKSETAYAVYQQHLSNRPVNVLR 2,701.39352 0.32 71.5 3
LENFGFIQFR 1,269.65054 0.49 53.5 3
GILAQLGYNSLDDIIGR 1,816.96825 0.56 132.5 20
ALYYLCEAADDAVR 1,571.72894 0.49 75.7 2
ISSFNPYGK 1,011.50250 0.29 41.5 13
EGLVMSLEVNIGK 1,419.72786 0.43 46.6 1
RLENFGFIQFR 1,425.75165 0.43 56.7 2
DALIALGCMEHR 1,327.63763 0.43 58.6 2
LHTGVGMIFLPQDDTFMQEAK 2,377.14458 0.49 35.7 1
LIGESNDYVGK 1,193.59276 0.27 73.7 49
VEPAVAIVQR 1,080.62909 0.29 88.8 94
AVNAGLLK 784.48064 0.25 60.4 24
HAGGPWELGLTETHQTLIANGLR 2,470.27164 0.47 88.2 2
EGLQVLGWR 1,056.57158 0.44 46.9 7
YSTNTSPR 924.43010 0.14 39 3
SNSGEGGEDPIR 1,216.53195 0.19 79.5 23
SSTVMENEEILR 1,422.66602 0.29 84 11
ISGLTFDELAR 1,220.64006 0.42 92.9 58
SGSQLLVLSDRSDR 1,531.79540 0.29 36.6 1
TPEEALMILVPEAYK 1,734.87494 0.52 72.3 6
FLGHNGEINTIQGNLNWMQSR 2,428.17053 0.48 49.1 2
ICHTNNCPVGVASQREELR 2,220.98511 0.31 63.9 1
ETMPNIQQVFVK 1,432.73839 0.44 76.2 4
SLIEAHVEK 1,024.55527 0.22 47.1 36
SDRAPIPVGK 1,038.58215 0.19 42.8 1
FCTGGMSLGAISR 1,378.58565 0.39 87.4 30
TQHLDLSYLLSSVGTPSLSSTEIR 2,603.34422 0.54 66.8 13
SQQAFGYSSEDVQMVIESMASQGK 2,606.16278 0.59 45.5 1
YPEVVDFYDYYK 1,599.71327 0.49 83.7 21
GNADIIQISGHDGGTGASPISSIK 2,294.15018 0.37 91 11
FLKPVNFK 991.58543 0.29 44.7 16
TSTGEVTFQSA 1,126.51421 0.31 50.2 6
VLSTYFDIR 1,112.58658 0.41 50.4 14
WKPLTDVVDGYSPTLPHLK 2,165.15205 0.44 46.7 3
FAQVTNPAIDPLREGLVMSLEVNIGK 2,842.48978 0.53 74.4 3
VAGVIAK 656.42206 0.17 31.1 2
PGEGGQLPGKK 1,066.57704 0.12 54 4
GMAGGEIVVTPVEK 1,385.72237 0.34 46.7 3
PGGEYHSNNPEMSK 1,545.65175 0.14 48.1 1
TSDNFVYVASEVGVVPVDEAK 2,224.08984 0.47 85.8 9
AFSEDTTK 897.40796 0.16 50.3 5
FGVTPTFLVNADQLEIK 1,891.00905 0.52 96.5 26
KQEVHTNGPVLDDDILADPLVIDAIENEKVVEK 3,654.89912 0.50 55.1 1
ENEIRPFGNPR 1,327.66324 0.26 40.1 16
ICHTNNCPVGVASQR 1,693.71477 0.28 83.2 18
ETHEAIAIAMNR 1,354.66629 0.31 63.7 3
INREIVK 870.52866 0.16 36.1 3
RYSTNTSPR 1,080.53120 0.10 42.4 8
DLLEFKSDR 1,121.57166 0.33 51.7 5
EGLVMSLEVNIGK 1,403.73294 0.42 41.4 1
GMAGGEIVVTPVEK 1,417.71220 0.30 127.5 54
FCTGGMSLGAISR 1,362.59073 0.36 28.3 1
ISGLTFDELARETLSFWVK 2,211.15750 0.70 49.6 1
SSTVMENEEILR 1,438.66093 0.29 100.4 68
EGLVMSLEVNIGKR 1,575.82896 0.40 41.7 1
LGPGMMIAVDLVNGQVYENTEVK 2,476.23407 0.59 50.6 2
ETHEAIAIAMNR 1,386.65613 0.24 90.5 59
SGVDVLMAAAMGADEYGFGSLAMIATGCVMAR 3,340.39125 0.70 91.2 5
ETMPNIQQVFVK 1,464.72823 0.38 79.7 55
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 3.97 1.09 94.93 1,626 STR
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 0 1 -