last update : january 2015

Public data retrieved in 2014



Home

AT5G03940 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT5G03940
Master Protein AT5G03940.1
Description (curated) FFC (FIFTY-FOUR CHLOROPLAST HOMOLOGUE); 7S RNA binding / GTP binding / mRNA binding
Calculated MW (PPDB) 61.23
Calculated PI (PPDB) 9.47
Length 564
Curated Annotation
Description (curated) cpSRP54 Chloroplast Signal Recognition particle 54 Kda subunit, chloroplast precursor /
Function (curated) protein targeting
Localization (curated) Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
PAAIDQLVILGEQVGVPVYTAGTDVKPADIAK 3,247.77028 0.59 47.2 2
RFVQSVSDQAVGMGVIR 1,879.95735 0.33 115.7 4
IVHDELVK 951.53890 0.23 32 2
NLMGVMEGGSIPALSGLEDALKAEQK 2,721.31999 0.51 45.7 1
ERPELLAESPERR 1,580.82701 0.23 44.2 3
QEDAEDLQK 1,074.48291 0.19 44.7 3
MEDLEPFYPDR 1,426.60745 0.39 55.8 1
LKGEEVLTK 1,015.59131 0.21 45.2 6
VSPAQIR 769.44461 0.19 50 6
LQIDKGMMDELKDVK 1,825.88011 0.28 49.2 2
TEQQVSALVAQIFQMR 1,863.95123 0.58 74.1 1
GVKPDQQLVK 1,110.63966 0.19 32.7 6
DNIAEPMR 960.43346 0.21 31.7 1
LKGEEVLTKDNIAEPMR 1,974.00912 0.28 68.6 2
ATEVMRQEDAEDLQKK 1,921.90508 0.16 71.1 4
LMGGEVSELQFAK 1,439.69656 0.36 79.2 4
EVSGKPIK 856.50177 0.09 40.6 1
ILGMGDVLSFVEK 1,422.74278 0.49 79.1 1
ERPELLAESPER 1,424.72591 0.27 93.4 8
ALLEADVSLPVVR 1,380.79761 0.46 62.3 6
FVESASSKPGPR 1,260.64619 0.17 66.3 18
VLGMIPGMGK 1,065.51981 0.29 60.2 8
SGPTVILLAGLQGVGK 1,508.89255 0.51 99 8
KNNVDVVIMDTAGR 1,562.77220 0.30 80.8 5
ATEVMRQEDAEDLQK 1,793.81012 0.20 56.5 7
NNVDVVIMDTAGR 1,434.67725 0.35 85.3 4
FDFNDFLK 1,044.49161 0.53 27 6
FVQSVSDQAVGMGVIR 1,707.86133 0.35 94.6 3
ILGMGDVLSFVEK 1,438.73770 0.49 84.2 9
MEDLEPFYPDR 1,442.60237 0.38 51 4
FVQSVSDQAVGMGVIR 1,723.85625 0.35 107.6 22
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 0 4.3 95.7 144 STR
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 1.7079 0.00127 LAM_high