last update : january 2015

Public data retrieved in 2014



Home

AT4G38970 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT4G38970
Master Protein AT4G38970.1
Description (curated) fructose-bisphosphate aldolase, putative
Calculated MW (PPDB) 42.98
Calculated PI (PPDB) 6.78
Length 398
Curated Annotation
Description (curated) FBA2 (SFBA-2, ALFC2) fructose-bisphosphate aldolase 2, chloroplast precursor /
Function (curated) metabolism carbon Calvin cycle
Localization (curated) Ch/S & Ch/E & Ch/Th
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
TYDVAEK 824.39157 0.17 48.3 13
GLVPLVGSNNESWCQGLDGLSSR 2,435.13861 0.55 114.7 1
GILAMDESNATCGKR 1,644.70828 0.25 112.7 53
YAAISQDSGLVPIVEPEILLDGEHDIDR 3,063.53998 0.55 118.9 48
YTGEGESEEAK 1,198.49892 0.14 81.2 78
PENVNAAQTTLLAR 1,496.79466 0.32 100.6 4
ALQNTCLK 889.46912 0.26 38.5 1
TIASPGR 700.38676 0.14 38.6 1
MVDVLVEQNIVPGIKVDK 1,995.10736 0.48 68.7 2
KMVDVLVEQNIVPGIK 1,813.00185 0.40 124.9 21
MVDVLVEQNIVPGIK 1,684.90689 0.45 103.9 65
MVDVLVEQNIVPGIK 1,652.91705 0.49 84.7 8
KMVDVLVEQNIVPGIK 1,781.01201 0.43 35.7 1
PSMVTPGAESK 1,118.52774 0.15 54.8 9
ANSLAQLGK 900.50284 0.25 77.1 76
RLDSIGLENTEANRQAFR 2,089.06639 0.31 65.8 4
ATPEQVAAYTLKLLR 1,672.95116 0.57 73.2 2
ATPEQVAAYTLK 1,290.68193 0.36 87.1 80
MVDVLVEQNIVPGIK 1,668.91197 0.45 117.3 29
GILAMDESNATCGK 1,488.60718 0.30 106.5 28
RLDSIGLENTEANR 1,586.80119 0.28 124.2 113
YAAISQDSGLVPIVEPEILLDGEHDIDRTYDVAEK 3,869.92099 0.54 74.1 2
PSMVTPGAESK 1,134.52266 0.16 49.3 4
PSMVTPGAESK 1,102.53282 0.19 62 2
TWGGRPENVNAAQTTLLAR 2,054.06567 0.35 110.1 31
GILAMDESNATCGK 1,472.61226 0.28 100.1 6
LDSIGLENTEANR 1,430.70009 0.31 104.8 110
GILAMDESNATCGKR 1,628.71336 0.24 90.2 8
TLLVSAPGLGQYVSGAILFEETLYQSTTEGK 3,271.68628 0.73 102.9 9
TLLVSAPGLGQYVSGAILFEETLYQSTTEGKK 3,399.78124 0.66 76.7 12
MVDVLVEQNIVPGIKVDK 2,027.09720 0.42 105.3 21
KMVDVLVEQNIVPGIK 1,797.00693 0.39 76.6 3
EAAWGLAR 872.45041 0.32 63.2 25
LDSIGLENTEANRQAFR 1,932.96529 0.33 53.9 7
KMVDVLVEQNIVPGIKVDK 2,155.19215 0.38 56.2 2
ALQNTCLK 937.45386 0.22 66.9 30
MVDVLVEQNIVPGIKVDK 2,011.10228 0.41 41.5 1
DRATPEQVAAYTLK 1,561.80998 0.33 66.8 13
AKANSLAQLGK 1,099.63490 0.20 93.3 70
TVVSIPNGPSALAVK 1,451.83472 0.38 78.2 98
TAAYYQQGAR 1,127.53593 0.20 68.5 51
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 15.22 12.77 72.01 1,114 STR
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 2.49614 0 LAM_high