last update : january 2015

Public data retrieved in 2014



Home

AT4G38970 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT4G38970
Master Protein AT4G38970.1
Description (curated) fructose-bisphosphate aldolase, putative
Calculated MW (PPDB) 42.98
Calculated PI (PPDB) 6.78
Length 398
Curated Annotation
Description (curated) FBA2 (SFBA-2, ALFC2) fructose-bisphosphate aldolase 2, chloroplast precursor /
Function (curated) metabolism carbon Calvin cycle
Localization (curated) Ch/S & Ch/E & Ch/Th
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
TAAYYQQGAR 1,127.53593 0.20 68.5 51
YTGEGESEEAK 1,198.49892 0.14 81.2 78
RLDSIGLENTEANR 1,586.80119 0.28 124.2 113
YAAISQDSGLVPIVEPEILLDGEHDIDR 3,063.53998 0.55 118.9 48
GILAMDESNATCGK 1,488.60718 0.30 106.5 28
EAAWGLAR 872.45041 0.32 63.2 25
ALQNTCLK 889.46912 0.26 38.5 1
PENVNAAQTTLLAR 1,496.79466 0.32 100.6 4
MVDVLVEQNIVPGIKVDK 2,011.10228 0.41 41.5 1
ATPEQVAAYTLKLLR 1,672.95116 0.57 73.2 2
MVDVLVEQNIVPGIK 1,668.91197 0.45 117.3 29
YAAISQDSGLVPIVEPEILLDGEHDIDRTYDVAEK 3,869.92099 0.54 74.1 2
KMVDVLVEQNIVPGIK 1,797.00693 0.39 76.6 3
ANSLAQLGK 900.50284 0.25 77.1 76
KMVDVLVEQNIVPGIK 1,813.00185 0.40 124.9 21
TYDVAEK 824.39157 0.17 48.3 13
KMVDVLVEQNIVPGIK 1,781.01201 0.43 35.7 1
GILAMDESNATCGKR 1,628.71336 0.24 90.2 8
MVDVLVEQNIVPGIK 1,652.91705 0.49 84.7 8
MVDVLVEQNIVPGIKVDK 2,027.09720 0.42 105.3 21
PSMVTPGAESK 1,102.53282 0.19 62 2
ATPEQVAAYTLK 1,290.68193 0.36 87.1 80
TLLVSAPGLGQYVSGAILFEETLYQSTTEGK 3,271.68628 0.73 102.9 9
TIASPGR 700.38676 0.14 38.6 1
GLVPLVGSNNESWCQGLDGLSSR 2,435.13861 0.55 114.7 1
RLDSIGLENTEANRQAFR 2,089.06639 0.31 65.8 4
MVDVLVEQNIVPGIK 1,684.90689 0.45 103.9 65
PSMVTPGAESK 1,134.52266 0.16 49.3 4
GILAMDESNATCGKR 1,644.70828 0.25 112.7 53
TWGGRPENVNAAQTTLLAR 2,054.06567 0.35 110.1 31
LDSIGLENTEANR 1,430.70009 0.31 104.8 110
TLLVSAPGLGQYVSGAILFEETLYQSTTEGKK 3,399.78124 0.66 76.7 12
LDSIGLENTEANRQAFR 1,932.96529 0.33 53.9 7
PSMVTPGAESK 1,118.52774 0.15 54.8 9
AKANSLAQLGK 1,099.63490 0.20 93.3 70
MVDVLVEQNIVPGIKVDK 1,995.10736 0.48 68.7 2
GILAMDESNATCGK 1,472.61226 0.28 100.1 6
ALQNTCLK 937.45386 0.22 66.9 30
KMVDVLVEQNIVPGIKVDK 2,155.19215 0.38 56.2 2
DRATPEQVAAYTLK 1,561.80998 0.33 66.8 13
TVVSIPNGPSALAVK 1,451.83472 0.38 78.2 98
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 15.22 12.77 72.01 1,114 STR
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 2.49614 0 LAM_high