last update : january 2015

Public data retrieved in 2014



Home

AT1G03130 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT1G03130
Master Protein AT1G03130.1
Description (curated) PSAD-2 (photosystem I subunit D-2)
Calculated MW (PPDB) 22.3
Calculated PI (PPDB) 9.78
Length 204
Curated Annotation
Description (curated) PSAD2 Photosystem I reaction center subunit II-2, chloroplast precursor
Function (curated) PS PSI
Localization (curated) Ch/Th
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
EGPNLLK 769.43336 0.25 41.1 16
ANPGREGVGLNMR 1,369.68838 0.25 43.8 1
KAQVEEFYVITWNSPK 1,937.98865 0.43 139.3 8
EQCLALGTR 1,037.48112 0.28 38.5 4
TESSSAAPAVK 1,046.52437 0.13 40 5
VFPNGEVQYLHPK 1,526.78810 0.33 71.7 13
FTGKQSYDL 1,057.50800 0.29 51.7 3
EGVGLNMR 906.42287 0.21 45.9 23
NVSPIEVKFTGK 1,317.72919 0.32 39.3 3
EQIFEMPTGGAAIMR 1,713.77016 0.39 118.4 81
EQIFEMPTGGAAIMR 1,681.78032 0.34 101.4 14
EQIFEMPTGGAAIMR 1,649.79048 0.47 64.2 2
EGVGLNMR 890.42795 0.19 37.5 5
DGVYPEKANPGR 1,301.63635 0.18 60.8 9
KEQCLALGTR 1,165.57608 0.23 92.9 64
NVSPIEVK 884.49669 0.24 45.4 16
EQIFEMPTGGAAIMR 1,665.78540 0.40 64.8 2
LARKEQCLALGTR 1,505.79836 0.22 54 3
SIGKNVSPIEVK 1,269.72919 0.25 61.7 6
EQIFEMPTGGAAIMR 1,697.77524 0.35 120.6 28
ANPGREGVGLNMR 1,401.67822 0.19 50 10
EGVGLNMR 874.43303 0.17 45 3
EAPVGFTPPQLDPNTPSPIFAGSTGGLLR 2,935.50789 0.54 106.6 42
AEKTESSSAAPAVK 1,374.69902 0.12 78.8 5
NVSPIEVKFTGKQSYDL 1,923.99412 0.41 64.2 2
ANPGREGVGLNMR 1,385.68330 0.20 33.6 1
EAPVGFTPPQLDPNTPSPIFAGSTGGLLRK 3,063.60284 0.49 103.5 15
DGVYPEK 806.38100 0.17 47.5 15
ITYQFYR 989.49704 0.34 53.5 20
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 21.02 78.8 0.17 401 THY-ENV