last update : january 2015

Public data retrieved in 2014



Home

AT1G03130 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT1G03130
Master Protein AT1G03130.1
Description (curated) PSAD-2 (photosystem I subunit D-2)
Calculated MW (PPDB) 22.3
Calculated PI (PPDB) 9.78
Length 204
Curated Annotation
Description (curated) PSAD2 Photosystem I reaction center subunit II-2, chloroplast precursor
Function (curated) PS PSI
Localization (curated) Ch/Th
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
SIGKNVSPIEVK 1,269.72919 0.25 61.7 6
EAPVGFTPPQLDPNTPSPIFAGSTGGLLRK 3,063.60284 0.49 103.5 15
EGVGLNMR 890.42795 0.19 37.5 5
ANPGREGVGLNMR 1,385.68330 0.20 33.6 1
NVSPIEVKFTGKQSYDL 1,923.99412 0.41 64.2 2
EQIFEMPTGGAAIMR 1,665.78540 0.40 64.8 2
EGVGLNMR 874.43303 0.17 45 3
EQIFEMPTGGAAIMR 1,697.77524 0.35 120.6 28
AEKTESSSAAPAVK 1,374.69902 0.12 78.8 5
KAQVEEFYVITWNSPK 1,937.98865 0.43 139.3 8
DGVYPEKANPGR 1,301.63635 0.18 60.8 9
LARKEQCLALGTR 1,505.79836 0.22 54 3
TESSSAAPAVK 1,046.52437 0.13 40 5
DGVYPEK 806.38100 0.17 47.5 15
EQIFEMPTGGAAIMR 1,681.78032 0.34 101.4 14
EGVGLNMR 906.42287 0.21 45.9 23
KEQCLALGTR 1,165.57608 0.23 92.9 64
EAPVGFTPPQLDPNTPSPIFAGSTGGLLR 2,935.50789 0.54 106.6 42
ITYQFYR 989.49704 0.34 53.5 20
ANPGREGVGLNMR 1,369.68838 0.25 43.8 1
NVSPIEVKFTGK 1,317.72919 0.32 39.3 3
ANPGREGVGLNMR 1,401.67822 0.19 50 10
NVSPIEVK 884.49669 0.24 45.4 16
EGPNLLK 769.43336 0.25 41.1 16
FTGKQSYDL 1,057.50800 0.29 51.7 3
EQIFEMPTGGAAIMR 1,649.79048 0.47 64.2 2
EQCLALGTR 1,037.48112 0.28 38.5 4
EQIFEMPTGGAAIMR 1,713.77016 0.39 118.4 81
VFPNGEVQYLHPK 1,526.78810 0.33 71.7 13
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 21.02 78.8 0.17 401 THY-ENV