last update : january 2015

Public data retrieved in 2014



Home

AT4G24280 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT4G24280
Master Protein AT4G24280.1
Description (curated) CPHSC70-1 (chloroplast heat shock protein 70-1); ATP binding / unfolded protein binding
Calculated MW (PPDB) 76.5
Calculated PI (PPDB) 5.06
Length 718
Curated Annotation
Description (curated) cpHsc70-1 (cpHSP70-1) (DnaK homologue) heat shock protein 70-1, chloroplast precursor /
Function (curated) chaperone and protease
Localization (curated) Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
DENNNVKLECPAINK 1,747.80461 0.26 55.9 2
KDEGIDLLK 1,029.57059 0.31 40.1 6
VVGIDLGTTNSAVAAMEGGKPTIVTNAEGQR 3,055.56068 0.47 94 3
SGDRLVGQIAK 1,142.64072 0.22 31.4 2
LVGQIAK 727.45918 0.20 39.9 8
QFAAEEISAQVLRK 1,588.85724 0.37 77.9 8
VVGIDLGTTNSAVAAMEGGKPTIVTNAEGQR 3,087.55052 0.40 125 5
DEGIDLLKDK 1,144.59753 0.32 70.4 26
LTEAAEK 760.39665 0.10 42.5 15
IGSGSTQEIK 1,018.52945 0.18 69.2 23
IINEPTAASLAYGFDR 1,736.87329 0.44 120.7 45
DKQALQR 857.47189 0.08 38.5 2
QAVVNPENTFFSVKR 1,734.90524 0.36 60.2 9
KQDITITGASTLPK 1,471.82458 0.30 92.3 17
NTTLPTSK 860.46034 0.15 38.7 1
IPAVQELVRK 1,151.70259 0.30 38.4 1
NQADSVVYQTEK 1,380.65208 0.24 101.4 68
LSFKDIDEVILVGGSTR 1,847.99921 0.51 122.6 17
TPVENSLRDAK 1,228.64113 0.19 48.2 1
KLVDDASR 902.48212 0.14 52.5 29
DAIDTKNQADSVVYQTEK 2,023.96979 0.28 78.7 2
VRTPVENSLR 1,169.65163 0.21 53.3 8
KMNEVDEESKQVSYR 1,872.85230 0.19 110.7 4
KDEGIDLLKDK 1,272.69249 0.27 68.4 17
FEELCSDLLDRVR 1,641.76678 0.44 37.5 1
RQAVVNPENTFFSVKR 1,891.00635 0.32 53.6 2
RQAVVNPENTFFSVK 1,734.90524 0.37 65.8 6
LTEAAEKAK 959.52872 0.08 37.8 1
EFVRDNK 906.45589 0.11 37.4 1
FDIDANGILSVSAVDKGTGK 2,006.03195 0.43 32.6 1
MNEVDEESK 1,095.43898 0.13 26.3 1
DEVDQMVQEAER 1,447.62488 0.41 49.6 1
AKIELSSLTQTNMSLPFITATADGPK 2,765.41566 0.48 71.3 4
AVITVPAYFNDSQR 1,579.79941 0.42 61.2 35
VVGIDLGTTNSAVAAMEGGKPTIVTNAEGQR 3,071.55560 0.39 146.7 2
QDITITGASTLPK 1,343.72963 0.35 34.8 1
MNEVDEESKQVSYR 1,744.75734 0.23 104.1 4
DIDEVILVGGSTR 1,372.71976 0.42 74 22
QDITITGASTLPKDEVDQMVQEAER 2,805.33379 0.41 91.2 2
VVRDENNNVKLECPAINK 2,102.04253 0.24 96.9 7
KMNEVDEESK 1,239.52885 0.12 69.8 9
QFAAEEISAQVLR 1,460.76228 0.44 112.3 61
FLNDKVTK 963.53890 0.20 58.2 7
IAGLEVLR 869.53340 0.36 67.2 61
IINEPTAASLAYGFDRK 1,864.96825 0.38 108.8 1
DEGIDLLKDKQALQR 1,740.93697 0.33 35 1
TTPSVVAYTK 1,065.57060 0.25 32.1 2
DEGIDLLK 901.47563 0.38 40.8 4
MNEVDEESK 1,111.43390 0.13 63.5 8
IPAVQELVR 1,023.60764 0.35 64.2 79
TPVENSLR 914.48212 0.20 61 24
VVRDENNNVK 1,185.61014 0.08 63.4 17
ELGEKIPGEVK 1,197.66043 0.25 48.5 3
LVGQIAKR 883.56029 0.16 60.1 5
LVDDASR 774.38716 0.13 57.4 14
AKFEELCSDLLDR 1,585.72934 0.41 113.9 20
HIETTLTR 969.52434 0.20 34.3 7
GVPQIEVK 868.50177 0.29 22.6 1
GGDGDDVIDADFTDSQ 1,625.63287 0.42 93.3 8
VVDWLAAEFK 1,176.61786 0.50 79.7 11
KQDITITGASTLPKDEVDQMVQEAER 2,933.42874 0.38 143.6 7
LQELKDK 872.49670 0.15 40.6 6
DEVDQMVQEAER 1,479.61472 0.30 51 2
IELSSLTQTNMSLPFITATADGPK 2,566.28360 0.52 131.3 7
AKFEELCSDLLDRVR 1,840.89885 0.40 87.1 7
QAVVNPENTFFSVK 1,578.80414 0.43 90.9 88
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 8.79 0.47 90.74 818 STR
Reference of the experiment Reference date Sample CAM Binding Protein
cam_bp 2013-01-01 00:00:00 CET Arabidopsis_stroma;
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 2.35973 0 LAM_high