last update : january 2015

Public data retrieved in 2014



Home

AT4G23100 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT4G23100
Master Protein AT4G23100.1
Description (curated) RML1 (ROOT MERISTEMLESS 1); glutamate-cysteine ligase
Calculated MW (PPDB) 58.56
Calculated PI (PPDB) 6.16
Length 522
Curated Annotation
Description (curated) GSH1 Glutamate--cysteine ligase
Function (curated) unknown
Localization (curated) Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
IGTEHEK 812.40280 0.07 40.7 2
VGTLGLDMMLR 1,268.61043 0.37 76 26
AVAEEMGIGFLGIGFQPK 1,878.95486 0.52 89.6 2
NKVPVTGLK 954.58617 0.20 52 2
VGTLGLDMMLR 1,236.62059 0.34 38.3 2
HVAEDVLK 909.49194 0.20 48.2 4
AVAEEMGIGFLGIGFQPK 1,862.95995 0.59 34.3 1
EAGFLNAVDEVVR 1,417.72006 0.49 83.5 12
REDIPIMPK 1,129.58012 0.24 36.1 7
VGTLGLDMMLR 1,252.61551 0.36 64.2 2
EDLIAYLASGCK 1,281.62744 0.59 54.5 1
AVAEEMGIGFLGIGFQPK 1,894.94978 0.52 95.6 5
AGLALQPIATALFANSPFTEGKPNGFLSMR 3,150.61710 0.59 71.8 1
TGVTPAEK 801.42320 0.13 41.4 2
EDLIAYLASGCK 1,329.61218 0.53 59.2 1
GRYDIMR 941.43887 0.20 30.7 1
YDQIAELLNGIAER 1,603.82053 0.55 98.6 4
VMEGDKIIGLK 1,233.66382 0.29 53.2 2
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 0 0 100 75 STR
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 0 1 -