last update : january 2015

Public data retrieved in 2014



Home

AT4G21280 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT4G21280
Master Protein AT4G21280.1
Description (curated) PSBQ/PSBQ-1/PSBQA; calcium ion binding
Calculated MW (PPDB) 23.79
Calculated PI (PPDB) 9.64
Length 223
Curated Annotation
Description (curated) PSBQ1 (OEE3-1, OEC16) 16 kDa polypeptide of oxygen-evolving complex, chloroplast precursor /
Function (curated) PS PSII OEE
Localization (curated) Ch/Th
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
YYAETVSALNEVLAKLG 1,839.96175 0.61 58.5 1
FYLQPLPPTEAAAR 1,572.82999 0.40 66.2 23
LFDTIDNLDYAAKK 1,625.83005 0.40 32.2 1
DIINVKPLIDRK 1,422.85580 0.34 63 10
DFALALK 776.44321 0.38 43.5 9
ESAKDIINVKPLIDR 1,709.96753 0.36 84.1 12
SLKDLTTK 904.52293 0.20 58.5 8
YDLNTIISSK 1,152.60263 0.41 44.5 1
KAWPYVQNDLR 1,388.72005 0.33 70.9 4
KSLKDLTTK 1,032.61789 0.17 47.5 5
KSPSQAEKYYAETVSALNEVLAK 2,525.30124 0.52 97.7 1
DLTTKLFDTIDNLDYAAK 2,056.03642 0.59 83.4 2
SPSQAEKYYAETVSALNEVLAK 2,397.20628 0.56 53.5 2
DRFYLQPLPPTEAAAR 1,843.95804 0.39 50.2 2
LFDTIDNLDYAAK 1,497.73509 0.44 103.6 36
VGPPPAPSGGLPGTDNSDQAR 1,988.95512 0.29 147.3 87
YDLNTIISSKPKDEK 1,749.91484 0.33 57 6
YYAETVSALNEVLAK 1,669.85623 0.46 119.4 15
DIINVKPLIDR 1,294.76085 0.38 73.2 30
SLKDLTTKLFDTIDNLDYAAK 2,384.24747 0.61 101.1 4
AWPYVQNDLR 1,260.62509 0.40 47 5
YDLNTIISSKPK 1,377.75035 0.35 93.5 12
VGPPPAPSGGLPGTDNSDQARDFALALK 2,747.38777 0.42 75.5 5
DFALALKDR 1,047.57126 0.33 62.4 41
VGPPPAPSGGLPGTDNSDQARDFALALKDR 3,018.51582 0.40 109.1 5
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 5.35 94.65 0 314 THY
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST -0.03832 1 -
Reference of the experiment Reference date Sample CAM Binding Protein
cam_bp 2013-01-01 00:00:00 CET Arabidopsis_membranes;