last update : january 2015

Public data retrieved in 2014



Home

AT4G20360 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT4G20360
Master Protein AT4G20360.1
Description (curated) AtRABE1b/AtRab8D (Arabidopsis Rab GTPase homolog E1b); translation elongation factor
Calculated MW (PPDB) 51.63
Calculated PI (PPDB) 5.83
Length 476
Curated Annotation
Description (curated) EFTU (EF-Tu-1, TUFA, RABE1b) elongation factor Tu, RAB GTPase homolog E1B, chloroplast precursor /
Function (curated) translation stroma / signalling / SNARE effector
Localization (curated) Ch/S & Ch/Th
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
QTELPFLLAVEDVFSITGR 2,134.13095 0.73 146.7 101
IVVELIVPVACEQGMR 1,834.91679 0.51 64.3 5
NMITGAAQMDGAILVVSGADGPMPQTK 2,752.27170 0.42 78.6 3
MVMPGDR 836.35204 0.14 27.3 5
EDQVDDAELLELVELEVR 2,113.04259 0.63 137.8 24
IYELMDAVDDYIPIPQR 2,066.00301 0.53 117.8 12
QVGVPDMVVFLNKEDQVDDAELLELVELEVR 3,571.79662 0.62 73 4
IMNDKDEESK 1,239.52887 0.07 82.7 84
GMVLAKPGSITPHTK 1,551.84425 0.22 25.5 1
HSPFFAGYR 1,080.51407 0.31 28.8 1
TTLTAALTMALASIGSSVAK 1,938.03430 0.66 106.9 58
HSPFFAGYRPQFYMR 1,934.88856 0.38 40.7 2
IMNDKDEESKMVMPGDR 2,089.86018 0.17 108.6 39
QVGVPDMVVFLNK 1,476.76459 0.42 67.8 21
GIQKADIQR 1,027.57741 0.14 73 7
MVMPGDR 868.34187 0.14 39.7 13
IVVELIVPVACEQGMR 1,818.92188 0.51 74.3 10
KPHVNIGTIGHVDHGK 1,707.91682 0.22 56.5 5
FEAIIYVLK 1,094.63753 0.47 65.6 40
ELLSSYEFNGDDIPIISGSALLAVETLTENPK 3,434.73436 0.72 95.5 15
EGGKTVGAGVIGTILE 1,499.81943 0.42 47.6 4
TVGAGVIGTILE 1,128.63898 0.51 79.4 64
QVGVPDMVVFLNK 1,460.76967 0.41 75.3 24
IMNDKDEESKMVMPGDR 2,057.87035 0.16 24.4 1
SYTVTGVEMFQK 1,388.66455 0.40 59.8 3
IYELMDAVDDYIPIPQR 2,050.00809 0.57 71.3 3
KKPHVNIGTIGHVDHGK 1,836.01178 0.20 91.9 4
QVGVPDMVVFLNK 1,444.77475 0.53 38.5 1
TTDVTGKVTK 1,048.57642 0.14 49 2
SYTVTGVEMFQK 1,404.65947 0.34 71.4 15
PGSITPHTK 936.50287 0.11 59 17
IMNDKDEESK 1,207.53903 0.11 74.6 4
VGETVDLVGLR 1,156.64513 0.38 116.6 201
GTVATGRVER 1,044.56755 0.12 49.7 10
SYTVTGVEMFQK 1,420.65439 0.34 75.9 40
TTLTAALTMALASIGSSVAK 1,906.04446 0.69 84.2 8
NMITGAAQMDGAILVVSGADGPMPQTK 2,720.28186 0.40 101 4
IYELMDAVDDYIPIPQR 2,081.99792 0.54 92.3 11
EHILLAK 822.49631 0.23 42.6 10
IMNDKDEESK 1,223.53395 0.10 59.8 25
TTLTAALTMALASIGSSVAK 1,922.03938 0.66 121 62
ILDEALAGDNVGLLLR 1,680.94096 0.51 129.5 146
KYDEIDAAPEER 1,434.66264 0.23 106.7 109
TTDVTGK 720.36537 0.09 41.9 6
NMITGAAQMDGAILVVSGADGPMPQTK 2,768.26662 0.43 131.3 16
VGETVDLVGLRETR 1,542.83650 0.33 63.3 42
VTKIMNDKDEESK 1,567.73991 0.09 40.1 1
MVMPGDRVK 1,095.50523 0.15 38.2 9
GTVATGR 660.35545 0.09 33.7 3
IMNDKDEESKMVMPGDR 2,073.86526 0.17 44.8 3
GITINTATVEYETENR 1,809.87442 0.38 118.6 58
KYDEIDAAPEERAR 1,661.80086 0.23 39.2 1
HYAHVDCPGHADYVK 1,758.74197 0.22 93.5 9
NMITGAAQMDGAILVVSGADGPMPQTK 2,736.27678 0.42 80.3 4
GMVLAKPGSITPHTK 1,567.83917 0.22 64 18
MVMPGDR 852.34695 0.14 28.8 5
YDEIDAAPEER 1,306.56769 0.26 77.5 27
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 8.2 19.09 72.71 1,376 STR-THY
Reference of the experiment Reference date Sample CAM Binding Protein
cam_bp 2013-01-01 00:00:00 CET Arabidopsis_stroma;Arabidopsis_membranes;
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 0.20723 0.49873 -