last update : january 2015

Public data retrieved in 2014



Home

AT4G20360 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT4G20360
Master Protein AT4G20360.1
Description (curated) AtRABE1b/AtRab8D (Arabidopsis Rab GTPase homolog E1b); translation elongation factor
Calculated MW (PPDB) 51.63
Calculated PI (PPDB) 5.83
Length 476
Curated Annotation
Description (curated) EFTU (EF-Tu-1, TUFA, RABE1b) elongation factor Tu, RAB GTPase homolog E1B, chloroplast precursor /
Function (curated) translation stroma / signalling / SNARE effector
Localization (curated) Ch/S & Ch/Th
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
NMITGAAQMDGAILVVSGADGPMPQTK 2,768.26662 0.43 131.3 16
SYTVTGVEMFQK 1,388.66455 0.40 59.8 3
IVVELIVPVACEQGMR 1,834.91679 0.51 64.3 5
HSPFFAGYRPQFYMR 1,934.88856 0.38 40.7 2
MVMPGDR 852.34695 0.14 28.8 5
MVMPGDR 868.34187 0.14 39.7 13
TTDVTGK 720.36537 0.09 41.9 6
FEAIIYVLK 1,094.63753 0.47 65.6 40
GIQKADIQR 1,027.57741 0.14 73 7
HYAHVDCPGHADYVK 1,758.74197 0.22 93.5 9
EHILLAK 822.49631 0.23 42.6 10
IMNDKDEESK 1,223.53395 0.10 59.8 25
TTLTAALTMALASIGSSVAK 1,938.03430 0.66 106.9 58
GTVATGR 660.35545 0.09 33.7 3
NMITGAAQMDGAILVVSGADGPMPQTK 2,720.28186 0.40 101 4
TVGAGVIGTILE 1,128.63898 0.51 79.4 64
QVGVPDMVVFLNKEDQVDDAELLELVELEVR 3,571.79662 0.62 73 4
NMITGAAQMDGAILVVSGADGPMPQTK 2,752.27170 0.42 78.6 3
SYTVTGVEMFQK 1,420.65439 0.34 75.9 40
IMNDKDEESKMVMPGDR 2,089.86018 0.17 108.6 39
ILDEALAGDNVGLLLR 1,680.94096 0.51 129.5 146
NMITGAAQMDGAILVVSGADGPMPQTK 2,736.27678 0.42 80.3 4
SYTVTGVEMFQK 1,404.65947 0.34 71.4 15
IMNDKDEESKMVMPGDR 2,057.87035 0.16 24.4 1
QTELPFLLAVEDVFSITGR 2,134.13095 0.73 146.7 101
QVGVPDMVVFLNK 1,476.76459 0.42 67.8 21
IMNDKDEESK 1,207.53903 0.11 74.6 4
TTLTAALTMALASIGSSVAK 1,906.04446 0.69 84.2 8
GTVATGRVER 1,044.56755 0.12 49.7 10
YDEIDAAPEER 1,306.56769 0.26 77.5 27
KKPHVNIGTIGHVDHGK 1,836.01178 0.20 91.9 4
PGSITPHTK 936.50287 0.11 59 17
TTLTAALTMALASIGSSVAK 1,922.03938 0.66 121 62
VGETVDLVGLRETR 1,542.83650 0.33 63.3 42
QVGVPDMVVFLNK 1,460.76967 0.41 75.3 24
ELLSSYEFNGDDIPIISGSALLAVETLTENPK 3,434.73436 0.72 95.5 15
MVMPGDRVK 1,095.50523 0.15 38.2 9
QVGVPDMVVFLNK 1,444.77475 0.53 38.5 1
EGGKTVGAGVIGTILE 1,499.81943 0.42 47.6 4
IMNDKDEESK 1,239.52887 0.07 82.7 84
TTDVTGKVTK 1,048.57642 0.14 49 2
IYELMDAVDDYIPIPQR 2,066.00301 0.53 117.8 12
VGETVDLVGLR 1,156.64513 0.38 116.6 201
VTKIMNDKDEESK 1,567.73991 0.09 40.1 1
KYDEIDAAPEER 1,434.66264 0.23 106.7 109
GMVLAKPGSITPHTK 1,551.84425 0.22 25.5 1
KYDEIDAAPEERAR 1,661.80086 0.23 39.2 1
IYELMDAVDDYIPIPQR 2,050.00809 0.57 71.3 3
EDQVDDAELLELVELEVR 2,113.04259 0.63 137.8 24
IYELMDAVDDYIPIPQR 2,081.99792 0.54 92.3 11
GMVLAKPGSITPHTK 1,567.83917 0.22 64 18
IVVELIVPVACEQGMR 1,818.92188 0.51 74.3 10
GITINTATVEYETENR 1,809.87442 0.38 118.6 58
MVMPGDR 836.35204 0.14 27.3 5
KPHVNIGTIGHVDHGK 1,707.91682 0.22 56.5 5
HSPFFAGYR 1,080.51407 0.31 28.8 1
IMNDKDEESKMVMPGDR 2,073.86526 0.17 44.8 3
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 8.2 19.09 72.71 1,376 STR-THY
Reference of the experiment Reference date Sample CAM Binding Protein
cam_bp 2013-01-01 00:00:00 CET Arabidopsis_stroma;Arabidopsis_membranes;
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 0.20723 0.49873 -