last update : january 2015

Public data retrieved in 2014



Home

AT4G18480 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT4G18480
Master Protein AT4G18480.1
Description (curated) CHLI1 (CHLORINA 42); magnesium chelatase
Calculated MW (PPDB) 46.27
Calculated PI (PPDB) 6.08
Length 424
Curated Annotation
Description (curated) CHLI1 (CS, CH-42) Magnesium-protoporphyrin IX chelatase subunit chlI, chloroplast precursor (EC 6.6.1.1) /
Function (curated) metabolism vitamin and pigment
Localization (curated) Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
ANLSSVQIDR 1,101.57780 0.27 86.3 37
VEKGEQVPVIATK 1,396.79251 0.23 84.8 25
KDPLESIDSGVLVSEK 1,714.89883 0.40 67.4 7
ANLSSVQIDRELK 1,471.79941 0.30 64.2 4
LRKDPLESIDSGVLVSEK 1,984.08400 0.37 95 9
ALTEGVK 716.40682 0.18 34.4 5
INMVDLPLGATEDR 1,574.76099 0.39 85 3
TEQDKLQDQISTAR 1,631.81146 0.25 97.5 20
FILIGSGNPEEGELRPQLLDR 2,352.24367 0.46 54.6 26
SLVDLLPEINVVAGDPYNSDPIDPEFMGVEVR 3,514.71765 0.67 121.4 3
IGGVMIMGDR 1,111.50014 0.28 76 44
DPLESIDSGVLVSEK 1,586.80388 0.45 120.6 10
LQDQISTAR 1,030.54071 0.22 54 10
IGGVMIMGDR 1,079.51030 0.26 68.1 9
FGMHAQVGTVR 1,233.59239 0.21 80.9 21
ALAALKGK 770.50137 0.15 30.7 2
ISRVCSELNVDGLRGDIVTNR 2,363.18623 0.38 70.8 2
PVYPFAAIVGQDEMK 1,695.81775 0.48 62.1 3
GDIVTNR 773.40314 0.19 29.2 2
IGGVMIMGDRGTGK 1,454.68568 0.23 73 4
INMVDLPLGATEDR 1,558.76607 0.38 99.3 6
ALTEGVKAFEPGLLAK 1,642.92932 0.39 37.3 3
ARFDSNPK 933.46680 0.14 32.7 1
VCSELNVDGLR 1,251.57646 0.38 42.5 3
IGGVMIMGDR 1,095.50522 0.27 43.2 4
VKIVEER 871.51266 0.16 43 5
ERVEKGEQVPVIATK 1,681.93620 0.21 66.3 19
AFEPGLLAK 944.53307 0.34 48.3 14
VTPDDVATVIPNCLR 1,659.81375 0.47 31.5 3
EGISISHPAR 1,065.55667 0.21 54.1 27
GEQVPVIATK 1,040.58656 0.27 78.6 23
FGMHAQVGTVR 1,217.59747 0.21 52.6 6
VCSELNVDGLRGDIVTNR 2,006.96904 0.40 91.6 9
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 2.3 0 97.7 342 STR
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 0 1 -