last update : january 2015

Public data retrieved in 2014



Home

AT1G15820 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT1G15820
Master Protein AT1G15820.1
Description (curated) LHCB6 (LIGHT HARVESTING COMPLEX PSII); chlorophyll binding
Calculated MW (PPDB) 27.52
Calculated PI (PPDB) 6.75
Length 258
Curated Annotation
Description (curated) LHCB6 (LHCII-6, CP24) photosystem II light harvesting complex gene 6, chlorophyll A-B binding protein CP24, chloroplast precursor /
Function (curated) PS LHCII
Localization (curated) Ch/Th
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
EAELIHGR 923.48244 0.17 67.2 49
DGVYEPDFEKLER 1,595.74669 0.38 79 50
GGGNFLDPEWLDGSLPGDFGFDPLGLGK 2,876.36560 0.68 65.2 5
SWIPAVK 799.45920 0.34 40.2 4
FFDPLGLAGK 1,063.57018 0.52 79.2 307
TAENFANYTGDQGYPGGRFFDPLGLAGK 2,962.38846 0.53 100.6 2
KSWIPAVK 927.55415 0.29 55.8 8
LAMVAMLIFYFEAGQGK 1,935.94736 0.62 96.8 10
DGVYEPDFEKLERLK 1,836.92570 0.42 30.1 1
TPLGALGL 740.44321 0.52 33.5 5
DGVYEPDFEK 1,197.51894 0.34 51.2 18
LKLAEIKHSR 1,193.72440 0.18 57.9 10
TAENFANYTGDQGYPGGRFFDPLGLAGKNR 3,232.53249 0.48 29.4 1
RWVDFFNPDSQSVEWATPWSK 2,581.20258 0.56 57.7 2
LAEIKHSR 952.54538 0.11 64.1 10
GGGNFLDPEWLDGSLPGDFGFDPLGLGKDPAFLK 3,547.72984 0.66 111.2 7
WVDFFNPDSQSVEWATPWSK 2,425.10147 0.61 125.9 5
LAMVAMLIFYFEAGQGK 1,951.94228 0.64 104.7 6
LKLAEIK 813.53235 0.25 47.6 21
FFDPLGLAGKNR 1,333.71420 0.43 79.7 14
NRDGVYEPDFEK 1,467.66296 0.28 74.1 13
LAMVAMLIFYFEAGQGK 1,919.95244 0.59 125.6 12
NRDGVYEPDFEKLER 1,865.89072 0.33 89.5 53
TAENFANYTGDQGYPGGR 1,916.82884 0.34 127.8 64
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST -2.13737 0 BBY_high
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 1.54 97.98 0.48 631 THY
Reference of the experiment Reference date Sample CAM Binding Protein
cam_bp 2013-01-01 00:00:00 CET Arabidopsis_membranes;