last update : january 2015

Public data retrieved in 2014



Home

AT3G60750 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT3G60750
Master Protein AT3G60750.1
Description (curated) transketolase, putative
Calculated MW (PPDB) 79.96
Calculated PI (PPDB) 5.93
Length 741
Curated Annotation
Description (curated) TKL-1 (TKTC) transketolase-1, chloroplast precursor /
Function (curated) metabolism carbon Calvin cycle
Localization (curated) Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
LIAFYDDNHISIDGDTEIAFTENVDQR 3,110.44682 0.77 108.2 27
YPEEASELK 1,064.50256 0.25 64.5 12
GGYTISDDSSGNKPDVILIGTGSELEIAAQAAEVLR 3,645.83723 0.66 131.9 35
SIGINSFGASAPAPLLYKEFGITVEAVVDAAK 3,234.71748 0.66 122.1 5
ISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHIASFR 3,962.94716 0.49 60.9 7
SGHPGLPMGCAPMAHILYDEVMR 2,481.14247 0.55 67.3 2
SGHPGLPMGCAPMAHILYDEVMR 2,625.09672 0.40 86.2 11
ISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHIASFR 3,946.95224 0.56 61.7 4
GGYTISDDSSGNKPDVILIGTGSELEIAAQAAEVLRK 3,773.93219 0.55 141.3 6
FLAIDAVEK 1,004.55420 0.37 69.3 102
ESVLPSDVSAR 1,158.58803 0.29 80.9 54
AMPNTLMFR 1,095.52049 0.34 39.2 1
ISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHIASFR 3,978.94208 0.50 181.6 13
KTPSILALSR 1,084.66042 0.31 76.2 65
VVSFVCWELFDEQSDEYK 2,269.97246 0.62 124.5 6
VSIEAASTFGWGK 1,351.67716 0.51 108.8 18
PADGNETAGAYK 1,192.53598 0.17 108 69
LPHLPGTSIEGVEK 1,475.79834 0.34 66.2 24
SIGINSFGASAPAPLLYK 1,804.97226 0.49 146.3 71
QKLPHLPGTSIEGVEK 1,731.95187 0.31 70.1 76
FLAIDAVEKAK 1,203.68626 0.33 63.8 10
VVSFVCWELFDEQSDEYKESVLPSDVSAR 3,410.54993 0.60 94.6 2
VTTTIGYGSPNK 1,236.63498 0.25 118.7 105
ALPTYTPESPGDATR 1,574.75763 0.31 104.2 109
FVLSAGHGCMLLYALLHLAGYDSVQEEDLK 3,371.60527 0.65 118.8 5
TPSILALSR 956.56546 0.37 77.2 43
FVLSAGHGCMLLYALLHLAGYDSVQEEDLK 3,355.61035 0.63 86 1
ANSYSVHGAALGEK 1,402.68402 0.23 100.2 54
VVPGFLGGSADLASSNMTLLK 2,076.09244 0.53 122.2 7
TVTDKPTLIK 1,114.65976 0.22 44.7 49
NNLGWPYEPFQVPDDVK 2,016.95808 0.51 90.2 20
NGNTGYDEIR 1,137.50502 0.23 93 65
FAAYEKK 855.44900 0.15 29.5 1
NLSQQCLNALAK 1,301.67613 0.42 58.3 2
ANSYSVHGAALGEKEVEATR 2,088.02350 0.26 138.7 21
AMPNTLMFR 1,143.50525 0.32 58 56
AMPNTLMFRPADGNETAGAYK 2,254.05100 0.40 35.5 2
HTPEGATLESDWSAK 1,627.74779 0.30 88 17
VVPGFLGGSADLASSNMTLLK 2,092.08736 0.48 153 36
AFGDFQK 811.38641 0.28 47 36
AMPNTLMFR 1,111.51541 0.29 42.2 9
TVTDKPTLIKVTTTIGYGSPNK 2,333.28418 0.35 44.5 1
EFGITVEAVVDAAK 1,447.75578 0.67 121.9 105
NPYWFNR 995.46132 0.37 53.2 9
FEALGWHVIWVK 1,483.79755 0.50 88.4 13
VVPGFLGGSADLASSNMTLLK 2,108.08228 0.51 163.9 111
AMPNTLMFR 1,079.52557 0.38 33.4 1
NLSQQCLNALAK 1,349.66087 0.37 109.2 62
TPGHPENFETPGIEVTTGPLGQGIANAVGLALAEK 3,484.78368 0.61 176.6 37
AAAVETVEPTTDSSIVDK 1,831.90506 0.31 103.2 6
SIITGELPAGWEK 1,399.73468 0.43 98.2 29
KYPEEASELK 1,192.59752 0.22 85.3 85
AMPNTLMFRPADGNETAGAYK 2,318.03067 0.33 98.1 40
AAIKEAK 729.43845 0.07 63.2 5
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 7.95 0.72 91.33 1,702 STR
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 0.83333 0.00127 LAM_medium