last update : january 2015

Public data retrieved in 2014



Home

AT3G52150 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT3G52150
Master Protein AT3G52150.1
Description (curated) RNA recognition motif (RRM)-containing protein
Calculated MW (PPDB) 27.74
Calculated PI (PPDB) 8.94
Length 253
Curated Annotation
Description (curated) PSRP-2 (CP33-like) similar to 30S-associated chloroplast RNA-binding protein cp33 /
Function (curated) translation stroma ?
Localization (curated) Ch/S & Ch/E
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
SVEDANAVVEK 1,159.57202 0.22 87.4 40
EMLENLFSEKGK 1,455.69148 0.35 38.1 1
TVTKEMLENLFSEK 1,699.83380 0.41 88.2 4
RFGFATMK 988.48000 0.26 41.7 3
VNITEKPIASSPDLSVLQSEDSAFVDSPYK 3,235.61354 0.47 102 5
SVEDANAVVEKLNGNTVEGR 2,100.04462 0.34 82.2 2
VQVMYDKYSGR 1,376.63940 0.23 36.9 1
VYVGNLAK 862.49120 0.25 31.1 2
VYIGNIPR 930.52866 0.31 42.8 5
LNGNTVEGR 958.48315 0.16 60.9 7
LVEEHGAVEK 1,109.57162 0.14 77.5 22
EMLENLFSEK 1,270.57507 0.41 48.2 11
TVTNEQLTK 1,032.54512 0.18 42.4 5
FGFATMK 832.37889 0.30 45.7 4
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 14.5 8.37 77.12 107 STR
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 0.64732 0.15204 -