last update : january 2015

Public data retrieved in 2014



Home

AT3G48870 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT3G48870
Master Protein AT3G48870.1
Description (curated) ATCLPC (CASEINOLYTIC PROTEASE C); ATP binding / ATPase
Calculated MW (PPDB) 105.77
Calculated PI (PPDB) 6.06
Length 952
Curated Annotation
Description (curated) ClpC2 (Hsp93-III) ATP-dependent Clp protease ATP-binding subunit /
Function (curated) chaperone and protease
Localization (curated) Ch/E & Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
TVDFKNTLLIMTSNVGSSVIEK 2,395.26678 0.57 40.9 1
VLENLGADPSNIR 1,396.73099 0.33 90 153
HIEKDPALER 1,206.63565 0.17 62.1 38
VGGFAAEEAMEDPIPIL 1,789.84434 0.59 32.6 2
VPEPTVEEAIQILQGLR 1,891.04141 0.64 103.9 1
ALAAYYFGSEEAMIR 1,722.79225 0.44 76.6 10
LGHNFVGTEQILLGLIGEGTGIAAK 2,507.37465 0.60 105.6 29
LDMSEFMER 1,188.47908 0.27 50.5 20
MPTLEEYGTNLTK 1,527.71265 0.37 100.4 59
RLGHNFVGTEQILLGLIGEGTGIAAK 2,663.47575 0.54 44.2 3
YRGEFEER 1,084.49371 0.19 42 24
QLTKLEVK 957.58585 0.22 29 1
IASGDVPETIEGK 1,314.66666 0.29 86.1 85
LIGSPPGYVGYTEGGQLTEAVR 2,263.14836 0.43 136.4 34
VIMLSQEEAR 1,206.59140 0.27 59.8 4
LDEMIVFR 1,053.51645 0.38 56.1 43
RVLELSLEEAR 1,313.73026 0.33 60 12
QYFRPEFLNR 1,368.69382 0.36 32 8
EKNEAVR 844.44023 0.05 37 2
NPNRPIASFIFSGPTGVGK 1,958.03731 0.43 112.1 74
QSDEIILFIDEVHTLIGAGAAEGAIDAANILKPALAR 3,815.04677 0.74 81.1 5
LAEEGKLDPVVGR 1,381.75645 0.27 90.5 86
GELQCIGATTIDEYRK 1,843.86214 0.42 82.2 28
AHPDVFNMMLQILEDGR 2,016.93968 0.45 85.7 11
VLELSLEEAR 1,157.62915 0.38 100.3 113
AHPDVFNMMLQILEDGR 2,048.92952 0.50 102.7 9
TAIAEGLAQR 1,028.56142 0.26 81.3 134
TKNNPCLIGEPGVGK 1,573.77693 0.28 79.3 13
EGEGVAAR 787.38237 0.11 51.5 25
LDMSEFMER 1,156.48924 0.43 43 1
TVITLDMGLLVAGTK 1,562.85890 0.48 49.5 1
NTLLIMTSNVGSSVIEK 1,836.95023 0.41 130.9 51
SLVTEELK 917.50693 0.31 40.7 15
FLPDKAIDLIDEAGSR 1,758.91516 0.45 98.4 30
LAEEGKLDPVVGRQPQIER 2,133.15413 0.28 49.2 5
MVGENNEVTASVGGGSSGNSK 2,011.87517 0.24 169.4 10
AHPDVFNMMLQILEDGR 2,032.93460 0.46 73.4 3
LLEDSMAEK 1,066.48521 0.20 61.6 54
NTLLIMTSNVGSSVIEK 1,820.95531 0.40 142.3 20
LDEMIVFR 1,021.52661 0.43 62.2 2
LDEMIVFR 1,037.52153 0.36 67.8 15
GSGFVAVEIPFTPR 1,475.77719 0.48 85.4 71
NNPCLIGEPGVGK 1,344.63429 0.33 78.4 10
TVITLDMGLLVAGTK 1,546.86398 0.46 49.2 2
AIDLIDEAGSR 1,158.58803 0.35 106.4 118
LDMSEFMER 1,220.46892 0.31 57.5 49
KLMEEIR 949.49023 0.18 46.8 12
SMGINLK 793.40036 0.23 51.6 10
MPTLEEYGTNLTK 1,511.71773 0.36 88.4 22
GELQCIGATTIDEYR 1,715.76718 0.49 40 2
SLVTEELKQYFRPEFLNR 2,268.19019 0.49 34 1
VGGFAAEEAMEDPIPIL 1,773.84943 0.57 58 2
HAQLPEEAR 1,049.52538 0.18 51.6 4
LDMSEFMER 1,172.48416 0.38 24.7 1
SMGINLK 777.40544 0.21 33.5 1
LLEDSMAEK 1,050.49030 0.19 59.5 22
LDPVVGR 754.43370 0.23 51.7 6
VEVEKIIGR 1,041.61818 0.27 61.7 5
VIGQDEAVK 957.51306 0.19 35.4 2
LLQMEQTLHTR 1,400.70819 0.23 58.1 3
AEIANVLSR 971.53995 0.31 33.7 2
ALAAYYFGSEEAMIR 1,706.79733 0.44 93.1 11
QLGHNYIGSEHLLLGLLR 2,032.12172 0.46 78.2 13
VVDEGFDPSYGAR 1,410.64150 0.32 44.9 2
EIELQVTER 1,115.58221 0.31 71.9 62
LDMSEFMER 1,204.47400 0.29 69.5 26
NTLLIMTSNVGSSVIEK 1,804.96039 0.45 66.6 1
VIMLSQEEAR 1,190.59648 0.26 47.4 1
MVGENNEVTASVGGGSSGNSK 1,995.88025 0.23 154.5 2
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 62.45 4.9 32.65 1,629 ENV-STR
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 0.89346 0.00476 LAM_medium