last update : january 2015

Public data retrieved in 2014



Home

AT3G48730 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT3G48730
Master Protein AT3G48730.1
Description (curated) GSA2 (GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE 2); glutamate-1-semialdehyde 2,1-aminomutase
Calculated MW (PPDB) 50.14
Calculated PI (PPDB) 7.01
Length 472
Curated Annotation
Description (curated) GSA2 (GSA-AT2) Glutamate-1-semialdehyde 2,1-aminomutase 2, chloroplast precursor /
Function (curated) metabolism vitamin and pigment
Localization (curated) Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
DIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLK 3,513.61351 0.47 91.4 2
DIDGNEYIDYVGSWGPAIIGHADDEVLAALAETMK 3,763.75623 0.74 151.7 2
GTSFGAPCLLENVLAEMVISAVPSIEMVR 3,112.51294 0.77 60.7 1
FVNSGTEACMGVLR 1,546.67551 0.33 109.2 7
GEIAAIILEPVVGNSGFITPKPEFIEGIR 3,065.67998 0.60 61 6
SDTEKFGK 910.43958 0.12 49.7 2
DNGALLIFDEVMTGFR 1,812.87157 0.63 113.4 7
NLMPGGVNSPVR 1,255.63425 0.26 62.1 20
ELTNGILEAGKK 1,271.70845 0.25 56.6 5
SEEAFNAAK 965.44537 0.18 59.5 22
KSDTEKFGK 1,038.53453 0.09 61.8 5
DNGALLIFDEVMTGFR 1,828.86649 0.63 119.3 25
LFEANKGEIAAIILEPVVGNSGFITPKPEFIEGIR 3,768.05002 0.58 145.4 10
DIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLK 3,449.63384 0.44 83 6
ELTNGILEAGK 1,143.61350 0.32 62.4 15
AGSGVATLGLPDSPGVPK 1,621.86746 0.38 88.6 74
DNGALLIFDEVMTGFR 1,796.87665 0.71 86.3 2
GTSFGAPCLLENVLAEMVISAVPSIEMVR 3,144.50278 0.78 77.3 4
LSQPGTYEYLDK 1,412.68233 0.32 69.3 13
NLMPGGVNSPVR 1,271.62917 0.27 62.9 45
IIGGGLPVGAYGGR 1,285.71417 0.36 87.1 53
PEFIEGIR 959.50758 0.36 43.7 2
DIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKR 3,669.71462 0.43 52.7 1
RLSQPGTYEYLDK 1,568.78343 0.31 46 1
SVGGQPVVMDSAK 1,305.62341 0.20 73.4 16
NLMPGGVNSPVR 1,239.63933 0.34 29.8 1
FVNSGTEACMGVLR 1,482.69585 0.42 60.5 1
ITKDNGALLIFDEVMTGFR 2,171.09318 0.55 144.9 3
FVNSGTEACMGVLR 1,562.67042 0.34 110.4 22
AATSDTLTAPYNDIAAVEK 1,949.95816 0.41 124 43
SVGGQPVVMDSAK 1,273.63358 0.25 53.7 4
LAYGGAQEYFGITPDLTTLGK 2,214.12077 0.53 114.3 29
SVGGQPVVMDSAK 1,289.62849 0.20 68.6 7
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 5.9 0.95 93.16 450 STR
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 0 1 -