last update : january 2015

Public data retrieved in 2014



Home

AT3G19170 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT3G19170
Master Protein AT3G19170.1
Description (curated) ATPREP1/ATZNMP (PRESEQUENCE PROTEASE 1); metalloendopeptidase
Calculated MW (PPDB) 121.01
Calculated PI (PPDB) 5.47
Length 1,080
Curated Annotation
Description (curated) PREP1Presequence protease 1
Function (curated) chaperone and protease
Localization (curated) Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
LRGSGHGIAAAR 1,164.64752 0.13 59.1 3
VTIEMQPDPEK 1,301.61729 0.23 91.8 4
HLLGVTDEER 1,167.58836 0.24 63.6 25
GSGHGIAAAR 895.46236 0.10 69.3 10
DFAQAIDVVR 1,132.58763 0.41 75 12
GVVFNEMK 954.44801 0.25 53.7 5
VSEEFISECKSK 1,432.63911 0.26 81.2 6
VSEEFISECK 1,217.51213 0.32 31.5 2
GLDVDQETLTK 1,217.61392 0.30 81.4 32
QETPDPPEALR 1,251.60951 0.27 46.8 5
GLSLMLQSISK 1,207.64819 0.40 78.3 15
EPTYVPTEVGDINGVK 1,716.85696 0.38 71.6 4
ATQEEVEEK 1,061.48764 0.14 38.8 6
QFVSQSR 850.42969 0.15 52.7 3
TLDIYDGTGDFLR 1,484.71469 0.47 96.5 10
VTIEMQPDPEK 1,317.61221 0.25 73.6 7
KTGGISVYPLTSSVR 1,563.86200 0.34 70.8 3
WIYDMDPFEPLK 1,568.72209 0.52 42.1 2
FLDLLPENPSGGLVTWDGR 2,085.05304 0.58 106.3 7
SLTNVEK 789.42320 0.17 57.7 4
AVFSPLIEK 1,002.57494 0.38 54.3 12
REEILTTSLK 1,188.67137 0.27 34.2 2
AAMTEEDLAELAR 1,434.66602 0.36 77 5
TGGISVYPLTSSVR 1,435.76704 0.39 71.5 2
DFKDFAQAIDVVR 1,522.77794 0.48 77.3 1
VFGVVFR 822.47514 0.41 38.2 3
VEELIMDTLK 1,221.61623 0.37 45 1
LILNNSHR 965.54063 0.19 50.8 6
EPFVELLK 973.54839 0.43 35.8 1
NGCIVNMTADGK 1,301.52272 0.30 64.9 4
SNFFEVKK 997.52322 0.27 33.3 2
ILLESGLGEALVSSGLSDELLQPQFGIGLK 3,082.68005 0.67 84.8 4
AIIGTIGDVDSYQLPDAK 1,874.96251 0.45 122.4 29
VLSEYLDMFEASPSPNSSK 2,131.96191 0.46 98.3 2
GVAVAVASAEDIDAANNER 1,870.90199 0.36 122.1 2
GYSSLLR 794.42862 0.30 35 1
VTIEMQPDPEKATQEEVEEK 2,361.08929 0.31 79.4 4
VEELIMDTLKK 1,349.71118 0.32 59.6 1
GVYSQPDNILGR 1,317.66766 0.34 70.3 21
KREEILTTSLK 1,316.76633 0.24 60.4 7
NEAIVIPTQVNYVGK 1,643.88820 0.40 105.3 17
VEELIMDTLK 1,205.62131 0.37 46.2 1
VKAAMTEEDLAELAR 1,677.82430 0.34 111.9 3
LFSEPVR 846.45992 0.28 36.8 1
HLLGVTDEERQR 1,451.74805 0.22 57.6 7
ATEELKLKQETPDPPEALR 2,164.13751 0.30 43 1
FKQFVSQSR 1,125.59305 0.22 58.7 8
TCYPVASTNTK 1,231.53905 0.23 30.4 1
GVSEENVQKVEELIMDTLKK 2,320.18310 0.52 39.3 2
GLSLMLQSISK 1,191.65328 0.39 62.9 2
AAMTEEDLAELAR 1,450.66093 0.38 108.2 44
DIPNLTFEEFK 1,351.66594 0.48 46.4 2
IAEEGSK 732.36534 0.08 46.1 5
LKQETPDPPEALR 1,492.78853 0.25 58.4 7
IAQQALSPENTYGVDSGGDPK 2,146.01778 0.32 120.6 10
DKGVAVAVASAEDIDAANNER 2,114.02390 0.36 167.4 4
CVPSLNLGDIPK 1,302.64891 0.47 38.4 1
ATEELKLK 930.53856 0.21 53.9 3
GVSEENVQK 988.48248 0.15 43.8 2
SNFFEVK 869.42827 0.35 68.9 4
ENNTGSFPR 1,020.46243 0.20 53.4 18
DLTFVQLNQLIGR 1,515.84088 0.54 67.9 17
ATQEEVEEKNILEK 1,658.83623 0.28 80.7 2
LVEKYPAGR 1,031.57632 0.18 42 7
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 0 0 100 426 STR
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 0 1 -