last update : january 2015

Public data retrieved in 2014



Home

AT3G16140 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT3G16140
Master Protein AT3G16140.1
Description (curated) PSAH-1 (photosystem I subunit H-1)
Calculated MW (PPDB) 15.21
Calculated PI (PPDB) 9.95
Length 145
Curated Annotation
Description (curated) PSAH-1 Photosystem I reaction center subunit VI-1, chloroplast precursor /
Function (curated) PS PSI
Localization (curated) Ch/Th
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
FFETFAAPFTKR 1,460.74518 0.43 67.5 28
RGPQEPPKLGPR 1,330.74692 0.17 66 4
GPQEPPKLGPR 1,174.64581 0.21 70.3 111
SVYFDLEDLGNTTGQWDVYGSDAPSPYNPLQSK 3,662.66882 0.59 159.4 2
FFETFAAPFTK 1,304.64407 0.50 92.5 64
RGPQEPPK 907.48753 0.08 48.4 1
GPQEPPK 751.38643 0.12 55.9 39
FLILGGGSLLTYVSATSTGEVLPIK 2,535.41989 0.63 87.7 1
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 2.64 97.36 0 244 THY
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 2.64929 0 LAM_high