last update : january 2015

Public data retrieved in 2014



Home

AT3G14930 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT3G14930
Master Protein AT3G14930.1
Description (curated) HEME1; uroporphyrinogen decarboxylase
Calculated MW (PPDB) 46.25
Calculated PI (PPDB) 6.64
Length 418
Curated Annotation
Description (curated)
Function (curated)
Localization (curated)
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
NMCHTAPDVLR 1,319.55980 0.25 31.3 2
GTGADVIGLDWTVDMADGR 1,963.89450 0.48 113.3 5
GPVIQSPIR 965.56578 0.30 30.8 3
RLHPIDFEK 1,153.62436 0.25 44.8 2
GQAISRPPAWMMR 1,563.72859 0.30 32.9 1
ALLSHLTK 881.53343 0.26 56.2 7
NLDYQTLFQNHVPAEK 1,915.94278 0.42 99.6 7
NMCHTAPDVLR 1,335.55472 0.26 60.6 6
YMAVYQK 933.42658 0.22 30.1 2
LQFVGDSLK 1,005.54945 0.35 70.2 15
LHPIDFEK 997.52325 0.30 24.1 1
EVGEHAAVLGFVGAPWTIATYIVEGGTTR 3,000.53439 0.66 31.5 1
GHILNLGHGVLVGTPEEAVAHFFETAR 2,870.48264 0.56 56.8 1
RLGSEVSVQGNVDPAYLFSPLPALTEEIER 3,285.68800 0.57 49.4 1
LGSEVSVQGNVDPAYLFSPLPALTEEIER 3,129.58690 0.65 73.3 2
NLDYQTLFQNHVPAEKAEPELVV 2,653.33870 0.49 56.3 2
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 0 0 100 49 STR