last update : january 2015

Public data retrieved in 2014



Home

AT2G40490 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT2G40490
Master Protein AT2G40490.1
Description (curated) HEME2; uroporphyrinogen decarboxylase
Calculated MW (PPDB) 43.58
Calculated PI (PPDB) 8.28
Length 394
Curated Annotation
Description (curated) DCUP (HEME2, UPD) Uroporphyrinogen decarboxylase, chloroplast precursor (EC 4.1.1.37) /
Function (curated) metabolism vitamin and pigment
Localization (curated) Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
VFKPDGVILFSDILTPLSGMNIPFDIVK 3,106.66635 0.65 78.3 9
NEVNNEAAVLGFVGAPFTLSSYVIEGGSSK 3,055.51369 0.64 94.7 2
KVSATSEPLLLR 1,312.77141 0.30 95.2 28
VLHALLQK 920.58070 0.24 48.4 13
LRNEVNNEAAVLGFVGAPFTLSSYVIEGGSSK 3,324.69885 0.59 157 2
FTTSMITYIR 1,247.62199 0.34 37.9 2
LAFSQPK 789.43846 0.24 33.7 2
GPIIFNPPQSAADVAQVR 1,878.99513 0.42 110.5 23
GKGPIIFNPPQSAADVAQVR 2,064.11154 0.38 118.7 11
QIVEAVK 785.46466 0.20 37.3 2
SYQTLCEKYPSFR 1,668.74533 0.35 40.1 1
GEVVDRPPVWLMR 1,552.81836 0.44 32.8 1
DKHILNLGHGIK 1,343.76732 0.24 37.8 1
DIAVQGNVDPGVLFGSK 1,714.88892 0.46 106.7 18
VFKPDGVILFSDILTPLSGMNIPFDIVK 3,090.67143 0.68 73 7
FTTSMITYIR 1,263.61691 0.37 74 8
EFVPEESVPYVGEALRR 1,976.00024 0.43 36.1 2
IHDTVKK 839.48648 0.07 32.4 3
VGTPEENVAHFFEVAQEIR 2,171.06464 0.55 59.7 4
EFVPEESVPYVGEALR 1,819.89914 0.47 73.2 14
QTHPNLPLILYASGSGGLLER 2,235.20110 0.48 76.2 3
VGTPEENVAHFFEVAQEIRY 2,334.12796 0.57 139.6 8
VSATSEPLLLR 1,184.67645 0.36 86.5 22
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 2.31 0 97.69 175 STR
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 0 1 -