last update : january 2015

Public data retrieved in 2014



Home

AT2G39730 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT2G39730
Master Protein AT2G39730.2
Description (curated) RCA (RUBISCO ACTIVASE)
Calculated MW (PPDB) 49.1
Calculated PI (PPDB) 7.54
Length 446
Curated Annotation
Description (curated) RCA Rubisco activase, chloroplast precursor /
Function (curated) metabolism carbon Calvin cycle chaperone and protease
Localization (curated) Ch/S & Ch/E
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
LMEYGNMLVMEQENVKR 2,178.95947 0.33 127 95
FVESLGVEK 1,006.53345 0.30 76.9 220
VPIICTGNDFSTLYAPLIRDGRMEK 2,888.40476 0.51 113.5 2
IGVCKGIFR 1,039.54839 0.33 82.3 32
ARVYDDEVR 1,121.54649 0.18 60.1 18
LMEYGNMLVMEQENVK 1,942.88377 0.39 78.2 2
GMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,387.54990 0.44 131.6 16
MGINPIMMSAGELESGNAGEPAK 2,383.03407 0.39 137.2 57
MGINPIMMSAGELESGNAGEPAK 2,335.04932 0.36 113.5 25
MGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNK 4,038.80667 0.49 59.5 1
VYDDEVR 894.40828 0.19 55.4 88
MCCLFINDLDAGAGR 1,613.69997 0.50 30.7 1
NFLTLPNIKVPLILGIWGGK 2,192.30844 0.63 79.7 12
LMEYGNMLVMEQENVK 2,006.86345 0.36 107.3 24
GMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,355.56006 0.43 106.2 19
EAADLIKK 886.51234 0.17 60.6 32
LMEYGNMLVMEQENVK 1,958.87869 0.35 98.5 2
LVVHITK 808.51704 0.22 64.6 101
TEEKEPSK 946.46071 0.08 48.9 36
MCCLFINDLDAGAGR 1,709.66945 0.57 106.8 9
VPIICTGNDFSTLYAPLIR 2,092.10265 0.60 113.6 4
MGINPIMMSAGELESGNAGEPAK 2,319.05440 0.44 130.5 5
LMEYGNMLVMEQENVKR 2,130.97472 0.31 67.9 12
NFLTLPNIK 1,058.61240 0.44 73.4 175
MGINPIMMSAGELESGNAGEPAK 2,351.04424 0.37 115.5 30
MGINPIMMSAGELESGNAGEPAK 2,303.05948 0.49 146.4 7
MGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNK 4,070.79651 0.51 121.4 3
ARVYDDEVRK 1,249.64145 0.15 43 18
KGKMCCLFINDLDAGAGR 2,038.87573 0.42 124 45
KFVESLGVEK 1,134.62840 0.26 92.2 227
MCCLFINDLDAGAGR 1,725.66437 0.58 121.1 59
IKDEDIVTLVDQFPGQSIDFFGALR 2,822.44898 0.64 132.4 75
YREAADLIK 1,077.58182 0.25 58.9 105
SFQCELVMAK 1,234.52094 0.39 89.2 206
VYDDEVRK 1,022.50324 0.15 55.8 181
GKMCCLFINDLDAGAGR 1,894.78586 0.49 71.7 3
LMEYGNMLVMEQENVK 1,926.88886 0.46 107 6
EGPPVFEQPEMTYEK 1,779.80249 0.40 73.1 9
LMEYGNMLVMEQENVK 2,022.85837 0.37 108 40
GKGMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,572.66631 0.41 38.7 2
LMEYGNMLVMEQENVKR 2,146.96964 0.31 59.5 13
KFVESLGVEKIGK 1,432.82887 0.28 42.7 2
MGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNK 4,006.81683 0.49 127.7 11
RVQLAETYLSQAALGDANADAIGR 2,502.28258 0.43 107.2 29
MGINPIMMSAGELESGNAGEPAK 2,367.03915 0.38 104 35
GIFRTDK 835.45517 0.18 32.8 3
QTDGDRWR 1,032.47369 0.18 28.6 1
LMEYGNMLVMEQENVK 1,974.87361 0.34 104.4 28
QYNLDNMMDGFYIAPAFMDK 2,447.01192 0.49 71.7 19
QYNLDNMMDGFYIAPAFMDK 2,431.01700 0.48 94.7 26
MGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNK 4,022.81175 0.49 105.9 2
FYWAPTREDR 1,339.63090 0.32 37.8 3
GMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,371.55498 0.44 118.3 16
VPIICTGNDFSTLYAPLIRDGR 2,468.23689 0.55 45.1 1
FVESLGVEKIGKR 1,460.83502 0.27 61.4 3
FVESLGVEKIGK 1,304.73392 0.31 73.9 5
GTFYGKTEEKEPSK 1,599.77798 0.17 71.1 23
GQGKSFQCELVMAK 1,604.71738 0.33 36.8 3
GMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,323.57022 0.49 112.4 6
YREAADLIKK 1,205.67677 0.21 42.1 9
GKMCCLFINDLDAGAGR 1,910.78078 0.48 126 41
DEDIVTLVDQFPGQSIDFFGALR 2,581.26996 0.72 90.2 4
SFQCELVMAK 1,218.52602 0.38 75.7 34
TDKIKDEDIVTLVDQFPGQSIDFFGALR 3,166.61856 0.59 130.3 39
LMEYGNMLVMEQENVKR 2,162.96455 0.32 76.1 21
IGVCKGIFRTDK 1,383.71797 0.29 74.9 6
LMEYGNMLVMEQENVK 1,990.86853 0.35 91.8 30
EAADLIK 758.41739 0.23 43.9 30
EDRIGVCK 966.44400 0.16 47.9 7
MGINPIMMSAGELESGNAGEPAKLIR 2,781.29822 0.42 144.1 17
GLAYDTSDDQQDITR 1,696.75401 0.30 125 313
MGINPIMMSAGELESGNAGEPAKLIR 2,717.31854 0.42 37.4 1
VQLAETYLSQAALGDANADAIGR 2,346.18147 0.47 180.9 170
EDRIGVCKGIFR 1,439.71902 0.31 53.6 9
GMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,339.56514 0.45 90.7 2
QYNLDNMMDGFYIAPAFMDK 2,399.02716 0.56 81.1 6
QYNLDNMMDGFYIAPAFMDK 2,383.03224 0.61 87.2 2
EGPPVFEQPEMTYEK 1,795.79741 0.35 77.7 85
EGPPVFEQPEMTYEK 1,811.79233 0.36 91 238
EGPPVFEQPEMTYEKLMEYGNMLVMEQENVKR 3,972.74124 0.55 39.3 4
LMEYGNMLVMEQENVKR 2,082.98996 0.44 122.4 3
QYNLDNMMDGFYIAPAFMDK 2,463.00684 0.50 74.8 23
VPIICTGNDFSTLYAPLIR 2,140.08739 0.62 116.1 91
VPLILGIWGGK 1,151.70660 0.59 87.7 117
MGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNK 4,054.80159 0.50 121.2 2
QYNLDNMMDGFYIAPAFMDKLVVHITK 3,173.53873 0.65 70.7 2
MGINPIMMSAGELESGNAGEPAK 2,399.02899 0.40 148.1 267
SFQCELVMAK 1,154.54636 0.42 53 3
GLAYDTSDDQQDITRGK 1,881.87042 0.26 83.8 4
VYDDEVRKFVESLGVEK 2,011.02612 0.48 50.3 13
QYNLDNMMDGFYIAPAFMDK 2,479.00176 0.52 87.6 54
QYNLDNMMDGFYIAPAFMDK 2,415.02208 0.51 58.4 1
FYWAPTR 939.46027 0.37 41.9 17
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 14.51 8.4 77.09 3,757 STR
Reference of the experiment Reference date Sample CAM Binding Protein
cam_bp 2013-01-01 00:00:00 CET Arabidopsis_stroma;Arabidopsis_membranes;Spinach_stroma_env;
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 1.41195 0 LAM_high