last update : january 2015

Public data retrieved in 2014



Home

AT2G39730 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT2G39730
Master Protein AT2G39730.2
Description (curated) RCA (RUBISCO ACTIVASE)
Calculated MW (PPDB) 49.1
Calculated PI (PPDB) 7.54
Length 446
Curated Annotation
Description (curated) RCA Rubisco activase, chloroplast precursor /
Function (curated) metabolism carbon Calvin cycle chaperone and protease
Localization (curated) Ch/S & Ch/E
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
NFLTLPNIK 1,058.61240 0.44 73.4 175
DEDIVTLVDQFPGQSIDFFGALR 2,581.26996 0.72 90.2 4
QYNLDNMMDGFYIAPAFMDK 2,399.02716 0.56 81.1 6
MGINPIMMSAGELESGNAGEPAK 2,303.05948 0.49 146.4 7
GMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,387.54990 0.44 131.6 16
VQLAETYLSQAALGDANADAIGR 2,346.18147 0.47 180.9 170
TDKIKDEDIVTLVDQFPGQSIDFFGALR 3,166.61856 0.59 130.3 39
YREAADLIKK 1,205.67677 0.21 42.1 9
EAADLIK 758.41739 0.23 43.9 30
VYDDEVRK 1,022.50324 0.15 55.8 181
LMEYGNMLVMEQENVK 1,942.88377 0.39 78.2 2
IGVCKGIFR 1,039.54839 0.33 82.3 32
MGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNK 4,054.80159 0.50 121.2 2
LMEYGNMLVMEQENVKR 2,162.96455 0.32 76.1 21
GIFRTDK 835.45517 0.18 32.8 3
KGKMCCLFINDLDAGAGR 2,038.87573 0.42 124 45
GMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,323.57022 0.49 112.4 6
QYNLDNMMDGFYIAPAFMDK 2,431.01700 0.48 94.7 26
SFQCELVMAK 1,218.52602 0.38 75.7 34
LMEYGNMLVMEQENVKR 2,178.95947 0.33 127 95
VPIICTGNDFSTLYAPLIRDGR 2,468.23689 0.55 45.1 1
LMEYGNMLVMEQENVK 1,974.87361 0.34 104.4 28
EGPPVFEQPEMTYEK 1,795.79741 0.35 77.7 85
GLAYDTSDDQQDITRGK 1,881.87042 0.26 83.8 4
GKMCCLFINDLDAGAGR 1,910.78078 0.48 126 41
GKMCCLFINDLDAGAGR 1,894.78586 0.49 71.7 3
LMEYGNMLVMEQENVKR 2,146.96964 0.31 59.5 13
FYWAPTR 939.46027 0.37 41.9 17
GMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,371.55498 0.44 118.3 16
FVESLGVEKIGKR 1,460.83502 0.27 61.4 3
MGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNK 4,070.79651 0.51 121.4 3
GMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,355.56006 0.43 106.2 19
EAADLIKK 886.51234 0.17 60.6 32
VYDDEVR 894.40828 0.19 55.4 88
FYWAPTREDR 1,339.63090 0.32 37.8 3
LMEYGNMLVMEQENVK 1,958.87869 0.35 98.5 2
LMEYGNMLVMEQENVKR 2,082.98996 0.44 122.4 3
EDRIGVCK 966.44400 0.16 47.9 7
MGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNK 4,038.80667 0.49 59.5 1
KFVESLGVEK 1,134.62840 0.26 92.2 227
QTDGDRWR 1,032.47369 0.18 28.6 1
GQGKSFQCELVMAK 1,604.71738 0.33 36.8 3
MGINPIMMSAGELESGNAGEPAK 2,383.03407 0.39 137.2 57
EGPPVFEQPEMTYEK 1,779.80249 0.40 73.1 9
MGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNK 4,006.81683 0.49 127.7 11
MCCLFINDLDAGAGR 1,709.66945 0.57 106.8 9
ARVYDDEVRK 1,249.64145 0.15 43 18
GKGMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,572.66631 0.41 38.7 2
GMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,339.56514 0.45 90.7 2
SFQCELVMAK 1,154.54636 0.42 53 3
VPIICTGNDFSTLYAPLIR 2,140.08739 0.62 116.1 91
MGINPIMMSAGELESGNAGEPAK 2,335.04932 0.36 113.5 25
MGINPIMMSAGELESGNAGEPAKLIR 2,781.29822 0.42 144.1 17
MGINPIMMSAGELESGNAGEPAK 2,399.02899 0.40 148.1 267
MGINPIMMSAGELESGNAGEPAK 2,351.04424 0.37 115.5 30
LMEYGNMLVMEQENVKR 2,130.97472 0.31 67.9 12
GTFYGKTEEKEPSK 1,599.77798 0.17 71.1 23
MGINPIMMSAGELESGNAGEPAKLIR 2,717.31854 0.42 37.4 1
QYNLDNMMDGFYIAPAFMDK 2,479.00176 0.52 87.6 54
ARVYDDEVR 1,121.54649 0.18 60.1 18
RVQLAETYLSQAALGDANADAIGR 2,502.28258 0.43 107.2 29
MGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNK 4,022.81175 0.49 105.9 2
QYNLDNMMDGFYIAPAFMDKLVVHITK 3,173.53873 0.65 70.7 2
IKDEDIVTLVDQFPGQSIDFFGALR 2,822.44898 0.64 132.4 75
VPLILGIWGGK 1,151.70660 0.59 87.7 117
FVESLGVEKIGK 1,304.73392 0.31 73.9 5
MCCLFINDLDAGAGR 1,725.66437 0.58 121.1 59
KFVESLGVEKIGK 1,432.82887 0.28 42.7 2
EDRIGVCKGIFR 1,439.71902 0.31 53.6 9
QYNLDNMMDGFYIAPAFMDK 2,463.00684 0.50 74.8 23
MCCLFINDLDAGAGR 1,613.69997 0.50 30.7 1
LMEYGNMLVMEQENVK 2,022.85837 0.37 108 40
YREAADLIK 1,077.58182 0.25 58.9 105
IGVCKGIFRTDK 1,383.71797 0.29 74.9 6
LMEYGNMLVMEQENVK 1,990.86853 0.35 91.8 30
TEEKEPSK 946.46071 0.08 48.9 36
LMEYGNMLVMEQENVK 2,006.86345 0.36 107.3 24
VPIICTGNDFSTLYAPLIR 2,092.10265 0.60 113.6 4
SFQCELVMAK 1,234.52094 0.39 89.2 206
EGPPVFEQPEMTYEKLMEYGNMLVMEQENVKR 3,972.74124 0.55 39.3 4
MGINPIMMSAGELESGNAGEPAK 2,319.05440 0.44 130.5 5
QYNLDNMMDGFYIAPAFMDK 2,447.01192 0.49 71.7 19
FVESLGVEK 1,006.53345 0.30 76.9 220
GLAYDTSDDQQDITR 1,696.75401 0.30 125 313
EGPPVFEQPEMTYEK 1,811.79233 0.36 91 238
VYDDEVRKFVESLGVEK 2,011.02612 0.48 50.3 13
NFLTLPNIKVPLILGIWGGK 2,192.30844 0.63 79.7 12
QYNLDNMMDGFYIAPAFMDK 2,415.02208 0.51 58.4 1
MGINPIMMSAGELESGNAGEPAK 2,367.03915 0.38 104 35
LMEYGNMLVMEQENVK 1,926.88886 0.46 107 6
QYNLDNMMDGFYIAPAFMDK 2,383.03224 0.61 87.2 2
LVVHITK 808.51704 0.22 64.6 101
VPIICTGNDFSTLYAPLIRDGRMEK 2,888.40476 0.51 113.5 2
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 14.51 8.4 77.09 3,757 STR
Reference of the experiment Reference date Sample CAM Binding Protein
cam_bp 2013-01-01 00:00:00 CET Arabidopsis_stroma;Arabidopsis_membranes;Spinach_stroma_env;
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 1.41195 0 LAM_high