last update : january 2015

Public data retrieved in 2014



Home

AT2G39730 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT2G39730
Master Protein AT2G39730.1
Description (curated) RCA (RUBISCO ACTIVASE)
Calculated MW (PPDB) 49.1
Calculated PI (PPDB) 7.54
Length 446
Curated Annotation
Description (curated) RCA Rubisco activase, chloroplast precursor /
Function (curated) chaperone and protease
Localization (curated) Ch & other
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
GIFRTDK 835.45517 0.18 32.8 3
GMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,323.57022 0.49 112.4 6
MGINPIMMSAGELESGNAGEPAK 2,383.03407 0.39 137.2 57
FVESLGVEKIGKR 1,460.83502 0.27 61.4 3
FYWAPTR 939.46027 0.37 41.9 17
GMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,339.56514 0.45 90.7 2
EGPPVFEQPEMTYEK 1,795.79741 0.35 77.7 85
LMEYGNMLVMEQENVK 1,974.87361 0.34 104.4 28
GLAYDTSDDQQDITRGK 1,881.87042 0.26 83.8 4
QYNLDNMMDGFYIAPAFMDK 2,399.02716 0.56 81.1 6
SFQCELVMAK 1,154.54636 0.42 53 3
LMEYGNMLVMEQENVK 1,990.86853 0.35 91.8 30
MGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNK 4,006.81683 0.49 127.7 11
LMEYGNMLVMEQENVKR 2,146.96964 0.31 59.5 13
MGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNK 4,070.79651 0.51 121.4 3
SFQCELVMAK 1,218.52602 0.38 75.7 34
VYDDEVR 894.40828 0.19 55.4 88
LMEYGNMLVMEQENVKR 2,130.97472 0.31 67.9 12
EDRIGVCKGIFR 1,439.71902 0.31 53.6 9
EGPPVFEQPEMTYEKLMEYGNMLVMEQENVKR 3,972.74124 0.55 39.3 4
QYNLDNMMDGFYIAPAFMDKLVVHITK 3,173.53873 0.65 70.7 2
LMEYGNMLVMEQENVK 2,006.86345 0.36 107.3 24
QYNLDNMMDGFYIAPAFMDK 2,415.02208 0.51 58.4 1
GLAYDTSDDQQDITR 1,696.75401 0.30 125 313
EAADLIKK 886.51234 0.17 60.6 32
TDKIKDEDIVTLVDQFPGQSIDFFGALR 3,166.61856 0.59 130.3 39
MGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNK 4,022.81175 0.49 105.9 2
KFVESLGVEK 1,134.62840 0.26 92.2 227
MGINPIMMSAGELESGNAGEPAK 2,319.05440 0.44 130.5 5
GKGMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,572.66631 0.41 38.7 2
MGINPIMMSAGELESGNAGEPAK 2,335.04932 0.36 113.5 25
IKDEDIVTLVDQFPGQSIDFFGALR 2,822.44898 0.64 132.4 75
MGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNK 4,038.80667 0.49 59.5 1
YREAADLIK 1,077.58182 0.25 58.9 105
IGVCKGIFR 1,039.54839 0.33 82.3 32
VPIICTGNDFSTLYAPLIR 2,092.10265 0.60 113.6 4
GKMCCLFINDLDAGAGR 1,894.78586 0.49 71.7 3
VPIICTGNDFSTLYAPLIRDGRMEK 2,888.40476 0.51 113.5 2
QYNLDNMMDGFYIAPAFMDK 2,431.01700 0.48 94.7 26
EGPPVFEQPEMTYEK 1,811.79233 0.36 91 238
VYDDEVRKFVESLGVEK 2,011.02612 0.48 50.3 13
QTDGDRWR 1,032.47369 0.18 28.6 1
DEDIVTLVDQFPGQSIDFFGALR 2,581.26996 0.72 90.2 4
FYWAPTREDR 1,339.63090 0.32 37.8 3
KFVESLGVEKIGK 1,432.82887 0.28 42.7 2
EAADLIK 758.41739 0.23 43.9 30
LMEYGNMLVMEQENVK 1,926.88886 0.46 107 6
RVQLAETYLSQAALGDANADAIGR 2,502.28258 0.43 107.2 29
GMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,371.55498 0.44 118.3 16
QYNLDNMMDGFYIAPAFMDK 2,463.00684 0.50 74.8 23
MCCLFINDLDAGAGR 1,613.69997 0.50 30.7 1
SFQCELVMAK 1,234.52094 0.39 89.2 206
GAQQVNLPVPEGCTDPVAENFDPTAR 2,772.26601 0.47 88.1 12
QYNLDNMMDGFYIAPAFMDK 2,447.01192 0.49 71.7 19
QYNLDNMMDGFYIAPAFMDK 2,383.03224 0.61 87.2 2
GMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,387.54990 0.44 131.6 16
GKMCCLFINDLDAGAGR 1,910.78078 0.48 126 41
GQGKSFQCELVMAK 1,604.71738 0.33 36.8 3
MGINPIMMSAGELESGNAGEPAK 2,351.04424 0.37 115.5 30
MGINPIMMSAGELESGNAGEPAKLIR 2,717.31854 0.42 37.4 1
QYNLDNMMDGFYIAPAFMDK 2,479.00176 0.52 87.6 54
LMEYGNMLVMEQENVK 2,022.85837 0.37 108 40
LMEYGNMLVMEQENVKR 2,082.98996 0.44 122.4 3
MGINPIMMSAGELESGNAGEPAK 2,303.05948 0.49 146.4 7
NFLTLPNIKVPLILGIWGGK 2,192.30844 0.63 79.7 12
MGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNK 4,054.80159 0.50 121.2 2
LMEYGNMLVMEQENVKR 2,178.95947 0.33 127 95
LVVHITK 808.51704 0.22 64.6 101
FVESLGVEKIGK 1,304.73392 0.31 73.9 5
FVESLGVEK 1,006.53345 0.30 76.9 220
MCCLFINDLDAGAGR 1,725.66437 0.58 121.1 59
VQLAETYLSQAALGDANADAIGR 2,346.18147 0.47 180.9 170
LMEYGNMLVMEQENVKR 2,162.96455 0.32 76.1 21
VPLILGIWGGK 1,151.70660 0.59 87.7 117
MGINPIMMSAGELESGNAGEPAKLIR 2,781.29822 0.42 144.1 17
MGINPIMMSAGELESGNAGEPAK 2,399.02899 0.40 148.1 267
ARVYDDEVR 1,121.54649 0.18 60.1 18
VYDDEVRK 1,022.50324 0.15 55.8 181
YREAADLIKK 1,205.67677 0.21 42.1 9
LMEYGNMLVMEQENVK 1,942.88377 0.39 78.2 2
ARVYDDEVRK 1,249.64145 0.15 43 18
LMEYGNMLVMEQENVK 1,958.87869 0.35 98.5 2
MGINPIMMSAGELESGNAGEPAK 2,367.03915 0.38 104 35
EGPPVFEQPEMTYEK 1,779.80249 0.40 73.1 9
VPIICTGNDFSTLYAPLIR 2,140.08739 0.62 116.1 91
MCCLFINDLDAGAGR 1,709.66945 0.57 106.8 9
IGVCKGIFRTDK 1,383.71797 0.29 74.9 6
KGKMCCLFINDLDAGAGR 2,038.87573 0.42 124 45
VPIICTGNDFSTLYAPLIRDGR 2,468.23689 0.55 45.1 1
NFLTLPNIK 1,058.61240 0.44 73.4 175
GMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,355.56006 0.43 106.2 19
EDRIGVCK 966.44400 0.16 47.9 7
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 14.51 8.4 77.09 3,757 STR