last update : january 2015

Public data retrieved in 2014



Home

AT2G39730 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT2G39730
Master Protein AT2G39730.1
Description (curated) RCA (RUBISCO ACTIVASE)
Calculated MW (PPDB) 49.1
Calculated PI (PPDB) 7.54
Length 446
Curated Annotation
Description (curated) RCA Rubisco activase, chloroplast precursor /
Function (curated) chaperone and protease
Localization (curated) Ch & other
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
LMEYGNMLVMEQENVK 1,974.87361 0.34 104.4 28
RVQLAETYLSQAALGDANADAIGR 2,502.28258 0.43 107.2 29
VPLILGIWGGK 1,151.70660 0.59 87.7 117
MGINPIMMSAGELESGNAGEPAK 2,399.02899 0.40 148.1 267
MGINPIMMSAGELESGNAGEPAKLIR 2,717.31854 0.42 37.4 1
MCCLFINDLDAGAGR 1,709.66945 0.57 106.8 9
KGKMCCLFINDLDAGAGR 2,038.87573 0.42 124 45
EGPPVFEQPEMTYEK 1,795.79741 0.35 77.7 85
FVESLGVEKIGKR 1,460.83502 0.27 61.4 3
FYWAPTREDR 1,339.63090 0.32 37.8 3
FVESLGVEKIGK 1,304.73392 0.31 73.9 5
VPIICTGNDFSTLYAPLIR 2,140.08739 0.62 116.1 91
VPIICTGNDFSTLYAPLIR 2,092.10265 0.60 113.6 4
GKGMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,572.66631 0.41 38.7 2
MGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNK 4,038.80667 0.49 59.5 1
LMEYGNMLVMEQENVK 1,958.87869 0.35 98.5 2
LMEYGNMLVMEQENVK 1,942.88377 0.39 78.2 2
VQLAETYLSQAALGDANADAIGR 2,346.18147 0.47 180.9 170
QTDGDRWR 1,032.47369 0.18 28.6 1
VPIICTGNDFSTLYAPLIRDGRMEK 2,888.40476 0.51 113.5 2
MGINPIMMSAGELESGNAGEPAKLIR 2,781.29822 0.42 144.1 17
MGINPIMMSAGELESGNAGEPAK 2,319.05440 0.44 130.5 5
VYDDEVRK 1,022.50324 0.15 55.8 181
KFVESLGVEKIGK 1,432.82887 0.28 42.7 2
EGPPVFEQPEMTYEKLMEYGNMLVMEQENVKR 3,972.74124 0.55 39.3 4
QYNLDNMMDGFYIAPAFMDK 2,415.02208 0.51 58.4 1
SFQCELVMAK 1,234.52094 0.39 89.2 206
IGVCKGIFR 1,039.54839 0.33 82.3 32
VYDDEVR 894.40828 0.19 55.4 88
EAADLIKK 886.51234 0.17 60.6 32
LMEYGNMLVMEQENVK 2,006.86345 0.36 107.3 24
LMEYGNMLVMEQENVKR 2,082.98996 0.44 122.4 3
EGPPVFEQPEMTYEK 1,811.79233 0.36 91 238
TDKIKDEDIVTLVDQFPGQSIDFFGALR 3,166.61856 0.59 130.3 39
MGINPIMMSAGELESGNAGEPAK 2,351.04424 0.37 115.5 30
MGINPIMMSAGELESGNAGEPAK 2,367.03915 0.38 104 35
NFLTLPNIKVPLILGIWGGK 2,192.30844 0.63 79.7 12
ARVYDDEVRK 1,249.64145 0.15 43 18
MGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNK 4,006.81683 0.49 127.7 11
LMEYGNMLVMEQENVK 2,022.85837 0.37 108 40
GIFRTDK 835.45517 0.18 32.8 3
GAQQVNLPVPEGCTDPVAENFDPTAR 2,772.26601 0.47 88.1 12
LMEYGNMLVMEQENVKR 2,178.95947 0.33 127 95
QYNLDNMMDGFYIAPAFMDK 2,399.02716 0.56 81.1 6
EDRIGVCKGIFR 1,439.71902 0.31 53.6 9
EGPPVFEQPEMTYEK 1,779.80249 0.40 73.1 9
IGVCKGIFRTDK 1,383.71797 0.29 74.9 6
GKMCCLFINDLDAGAGR 1,894.78586 0.49 71.7 3
GMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,323.57022 0.49 112.4 6
GLAYDTSDDQQDITR 1,696.75401 0.30 125 313
VYDDEVRKFVESLGVEK 2,011.02612 0.48 50.3 13
LVVHITK 808.51704 0.22 64.6 101
FVESLGVEK 1,006.53345 0.30 76.9 220
DEDIVTLVDQFPGQSIDFFGALR 2,581.26996 0.72 90.2 4
MGINPIMMSAGELESGNAGEPAK 2,303.05948 0.49 146.4 7
EAADLIK 758.41739 0.23 43.9 30
EDRIGVCK 966.44400 0.16 47.9 7
QYNLDNMMDGFYIAPAFMDK 2,479.00176 0.52 87.6 54
NFLTLPNIK 1,058.61240 0.44 73.4 175
GKMCCLFINDLDAGAGR 1,910.78078 0.48 126 41
GMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,355.56006 0.43 106.2 19
MGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNK 4,070.79651 0.51 121.4 3
KFVESLGVEK 1,134.62840 0.26 92.2 227
LMEYGNMLVMEQENVKR 2,130.97472 0.31 67.9 12
YREAADLIK 1,077.58182 0.25 58.9 105
QYNLDNMMDGFYIAPAFMDKLVVHITK 3,173.53873 0.65 70.7 2
MCCLFINDLDAGAGR 1,613.69997 0.50 30.7 1
GMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,371.55498 0.44 118.3 16
QYNLDNMMDGFYIAPAFMDK 2,383.03224 0.61 87.2 2
MGINPIMMSAGELESGNAGEPAK 2,335.04932 0.36 113.5 25
GQGKSFQCELVMAK 1,604.71738 0.33 36.8 3
MCCLFINDLDAGAGR 1,725.66437 0.58 121.1 59
QYNLDNMMDGFYIAPAFMDK 2,431.01700 0.48 94.7 26
MGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNK 4,054.80159 0.50 121.2 2
MGINPIMMSAGELESGNAGEPAK 2,383.03407 0.39 137.2 57
SFQCELVMAK 1,154.54636 0.42 53 3
FYWAPTR 939.46027 0.37 41.9 17
LMEYGNMLVMEQENVK 1,990.86853 0.35 91.8 30
MGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNK 4,022.81175 0.49 105.9 2
IKDEDIVTLVDQFPGQSIDFFGALR 2,822.44898 0.64 132.4 75
QYNLDNMMDGFYIAPAFMDK 2,447.01192 0.49 71.7 19
LMEYGNMLVMEQENVKR 2,146.96964 0.31 59.5 13
GMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,387.54990 0.44 131.6 16
ARVYDDEVR 1,121.54649 0.18 60.1 18
SFQCELVMAK 1,218.52602 0.38 75.7 34
VPIICTGNDFSTLYAPLIRDGR 2,468.23689 0.55 45.1 1
GMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR 3,339.56514 0.45 90.7 2
LMEYGNMLVMEQENVK 1,926.88886 0.46 107 6
YREAADLIKK 1,205.67677 0.21 42.1 9
LMEYGNMLVMEQENVKR 2,162.96455 0.32 76.1 21
QYNLDNMMDGFYIAPAFMDK 2,463.00684 0.50 74.8 23
GLAYDTSDDQQDITRGK 1,881.87042 0.26 83.8 4
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 14.51 8.4 77.09 3,757 STR