last update : january 2015

Public data retrieved in 2014



Home

AT2G37660 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT2G37660
Master Protein AT2G37660.1
Description (curated) binding / catalytic/ coenzyme binding
Calculated MW (PPDB) 34.88
Calculated PI (PPDB) 8.37
Length 325
Curated Annotation
Description (curated) Ycf39-like (Tic62-like) NAD-dependent epimerase,dehydratase family protein, chloroplast precursor /
Function (curated) protein targeting Tic ?
Localization (curated) Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
DGGIRELLVGKDDELLETETR 2,357.20735 0.43 55.1 2
ALFTQVTTK 1,007.56512 0.31 58 26
DTASIAPAVEGIDALVILTSAVPQMKPGFDPSK 3,337.74785 0.70 41.6 2
QIVLVGSMGGTNINHPLNSIGNANILVWKR 3,214.73959 0.51 56.4 2
AGGLQDKDGGIR 1,185.61014 0.18 67.3 22
ALDLASKPEGTGTPTKDFK 1,975.02617 0.27 81.5 26
AEQYLADSGIPYTIIR 1,808.93082 0.46 80.9 2
DTASIAPAVEGIDALVILTSAVPQMK 2,609.39853 0.74 31.6 1
ADVAEVCVQALQLEEAKFK 2,138.05644 0.46 115.5 6
SEQFVAR 835.41878 0.20 52.6 20
ALFTQVTTKF 1,154.63353 0.43 81.9 25
ELLVGKDDELLETETR 1,858.95233 0.38 134.2 42
KAEQYLADSGIPYTIIR 1,937.02577 0.42 106.2 6
DDELLETETR 1,219.55681 0.31 75.8 9
TGQIVYKK 935.54398 0.15 35.8 3
ALDLASKPEGTGTPTK 1,584.83586 0.24 77.2 60
TGQIVYK 807.44902 0.18 36.1 5
NQIDAAKAAGVK 1,184.65128 0.20 59.4 2
DTASIAPAVEGIDALVILTSAVPQMKPGFDPSK 3,369.73769 0.65 37.7 2
GGRPEFFFDDGAYPEQVDWIGQK 2,657.21857 0.51 99.8 6
EKINGEDEVFIGDIR 1,732.86310 0.37 90.3 12
ADVAEVCVQALQLEEAK 1,862.89308 0.44 95.9 14
INGEDEVFIGDIR 1,475.72556 0.42 98.2 18
AGGLQDK 687.35512 0.10 59.1 6
ADVAEVCVQALQLEEAK 1,814.90834 0.57 47.5 2
NQIDAAK 758.39224 0.11 46.3 14
ERSEQFVAR 1,120.56247 0.18 58.7 14
LKERSEQFVAR 1,361.74149 0.19 59.5 3
DTASIAPAVEGIDALVILTSAVPQMKPGFDPSK 3,353.74277 0.67 96.6 9
DTASIAPAVEGIDALVILTSAVPQMK 2,625.39345 0.72 43.8 3
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 5.26 0 94.74 353 STR
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 0 1 -