last update : january 2015

Public data retrieved in 2014



Home

AT2G37220 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT2G37220
Master Protein AT2G37220.1
Description (curated) 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative
Calculated MW (PPDB) 30.71
Calculated PI (PPDB) 5.05
Length 289
Curated Annotation
Description (curated) CP29 (ROC1, CP29 B') putative RNA-binding (RRM/RBD/RNP) protein, chloroplast precursor /
Function (curated) RNA Binding
Localization (curated) Ch/S & Ch/Th & Ch/E
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
GFGFVTYDSSQEVQNAIK 1,988.94789 0.46 115 19
VNAGPPPPK 875.48646 0.14 61.5 22
VNAGPPPPKREDGFSR 1,722.88010 0.21 35.8 7
SLDGADLDGR 1,017.47267 0.26 88.9 77
VSEAEARPPRR 1,266.67923 0.15 26.5 1
VIYDRDSGR 1,079.53593 0.16 44.9 16
SSFGSSGSGYGGGGGSGAGSGNR 1,905.78362 0.22 176.3 14
VSEAEARPPR 1,110.57812 0.16 51.8 50
REDGFSR 865.40419 0.14 47 18
SKGFGFVTYDSSQEVQNAIK 2,204.07488 0.43 47.7 1
EQSFSADLK 1,023.48726 0.28 45 8
VNAGPPPPKR 1,031.58757 0.12 63.5 19
GFGFVTMSSVSEVEAAAQQFNGYELDGRPLR 3,393.59343 0.55 145.4 4
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 12.48 34.83 52.69 239 STR-THY
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 0.33333 0.39904 -