last update : january 2015

Public data retrieved in 2014



Home

AT2G34430 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT2G34430
Master Protein AT2G34430.1
Description (curated) LHB1B1 (Photosystem II light harvesting complex gene 1.4); chlorophyll binding
Calculated MW (PPDB) 28.17
Calculated PI (PPDB) 5.15
Length 266
Curated Annotation
Description (curated) LHCB1.4 (LHCII-1.4) photosystem II light harvesting complex gene 1,4, chlorophyll A-B binding protein, chloroplast precursor /
Function (curated) PS LHCII
Localization (curated) Ch/Th
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
GPLENLADHLADPVNNNAWAFATNFVPGK 3,091.51508 0.58 115.2 17
VAGDGPLGEAEDLLYPGGSFDPLGLATDPEAFAELK 3,630.76160 0.70 104 19
LAMFSMFGFFVQAIVTGK 2,041.00520 0.73 133.1 109
PTGPSGSPWYGSDR 1,462.64768 0.30 80.5 3
VKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAR 4,193.95332 0.59 103.6 2
YLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAR 3,966.78996 0.61 111.2 2
FGEAVWFK 982.49120 0.48 61.9 40
LAMFSMFGFFVQAIVTGK 2,057.00012 0.70 153.6 88
VAGDGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVK 3,857.92496 0.64 188.9 4
ELEVIHSR 981.52431 0.22 62.2 147
NRELEVIHSR 1,251.66834 0.24 68.6 441
WAMLGALGCVFPELLAR 1,861.95821 0.63 109.7 4
LAMFSMFGFFVQAIVTGK 2,025.01028 0.70 133.7 85
ASKPTGPSGSPWYGSDRVK 1,975.97513 0.26 50.4 1
NGVKFGEAVWFK 1,380.71893 0.42 51.9 3
VKELKNGR 942.56100 0.06 41.4 3
WAMLGALGCVFPELLAR 1,909.94295 0.67 118.6 7
LAMFSMFGFFVQAIVTGK 2,009.01537 0.72 86.9 3
ASKPTGPSGSPWYGSDR 1,748.81177 0.26 101 18
LAMFSMFGFFVQAIVTGK 1,993.02045 0.69 36.2 2
WAMLGALGCVFPELLAR 1,925.93787 0.68 82.9 6
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST -1.40854 0 BBY_high
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 1.06 98.22 0.72 980 THY