last update : january 2015

Public data retrieved in 2014



Home

AT2G28000 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT2G28000
Master Protein AT2G28000.1
Description (curated) CPN60A (chloroplast / 60 kDa chaperonin alpha subunit); ATP binding / protein binding / unfolded protein binding
Calculated MW (PPDB) 62.07
Calculated PI (PPDB) 5.08
Length 586
Curated Annotation
Description (curated) RUBA (CPN60A, Cpn60-alpha-1) RuBisCO subunit binding-protein alpha subunit, chloroplast precursor /
Function (curated) chaperone and protease
Localization (curated) Ch/S & Ch/E
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
IMFSDWENGYNAMTDTYENLFEAGVIDPAK 3,440.52161 0.68 67.8 1
LADCVGLTLGPR 1,261.63359 0.42 69.6 11
ELFETDSVYDSEKLAER 2,029.94797 0.38 97.2 4
EIAFDQHSR 1,101.52029 0.21 60.7 52
AALQAGIDKLADCVGLTLGPR 2,081.13023 0.59 43.3 2
DSTTLIADAASKDELQAR 1,903.94867 0.36 103 65
TVQGLIEELQK 1,256.69757 0.45 89.8 39
APGFGER 732.35544 0.20 50 16
CALQNAASVAGMVLTTQAIVVDKPKPK 2,832.47243 0.56 113.1 9
NATFAAIEEGIVPGGGAALVHLSTVIPAIK 2,915.61191 0.60 81.2 13
AVASISAGNDDLIGSMIADAIDK 2,262.10487 0.51 106.5 1
GIDKTVQGLIEELQKK 1,798.01994 0.47 69.8 4
KELFETDSVYDSEK 1,688.77806 0.32 98.4 2
GRNVVLDEFGSPK 1,416.73605 0.32 71.5 2
APAAAAPEGLMV 1,112.55354 0.37 57.6 6
ITAIKDIIPILEK 1,465.91193 0.45 101.8 37
AIELPNAMENAGAALIR 1,768.91409 0.41 137 21
VGAATETELEDRK 1,417.70483 0.21 87.5 12
LGADIVQK 842.48613 0.23 84.5 31
NVVLDEFGSPK 1,203.61350 0.37 79.2 75
VLITDQK 815.47525 0.20 57.3 38
TNDSAGDGTTTASILAR 1,649.78563 0.30 148.6 53
VGAATETELEDR 1,289.60988 0.24 118.1 80
HGLLSVTSGANPVSLKR 1,734.97400 0.31 118.2 7
ETFEDADERLGADIVQK 1,934.92209 0.37 78.9 5
HGLLSVTSGANPVSLK 1,578.87289 0.35 115.6 40
AALQAGIDK 885.49194 0.21 60.4 14
APLLIIAEDVTGEALATLVVNK 2,249.28816 0.74 140.5 88
APLLIIAEDVTGEALATLVVNKLR 2,518.47333 0.76 72.7 1
GYISPQFVTNPEK 1,478.74049 0.36 113.5 32
AVASISAGNDDLIGSMIADAIDK 2,278.09979 0.53 178.9 8
DIIPILEK 939.56406 0.42 48 8
LSGGVAVIK 842.52249 0.26 65.4 34
GIDKTVQGLIEELQK 1,669.92499 0.50 72.7 6
VVNDGVTIAR 1,042.57706 0.25 93.2 55
APAAAAPEGLMV 1,128.54846 0.38 69.9 18
AALQAGIDKLADCVGLTLGPR 2,129.11498 0.49 87.2 3
DSTTLIADAASK 1,191.59828 0.32 93.1 11
TVQGLIEELQKK 1,384.79253 0.40 73.6 8
NATFAAIEEGIVPGGGAALVHLSTVIPAIKETFEDADER 4,008.04787 0.61 31.8 1
AIELPNAMENAGAALIR 1,752.91917 0.51 77.5 4
ALLSPAALIAQNAGVEGEVVVEK 2,277.25789 0.52 132.9 15
GVLNVVAVK 897.56468 0.33 75.8 44
AIELPNAMENAGAALIR 1,784.90901 0.42 145.3 83
ETFEDADER 1,110.44652 0.22 79 25
ELFETDSVYDSEK 1,560.68310 0.37 86.6 38
LLAEFENAR 1,061.55051 0.33 72.3 110
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 17.35 0.38 82.27 1,195 STR-ENV
Reference of the experiment Reference date Sample CAM Binding Protein
cam_bp 2013-01-01 00:00:00 CET Arabidopsis_stroma;
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 3.06064 0 LAM_high