last update : january 2015

Public data retrieved in 2014



Home

AT2G21330 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT2G21330
Master Protein AT2G21330.1
Description (curated) fructose-bisphosphate aldolase, putative
Calculated MW (PPDB) 42.93
Calculated PI (PPDB) 6.17
Length 399
Curated Annotation
Description (curated) FBA1 (SFBA-1, ALFC1) fructose bisphosphate aldolase 1, chloroplast precursor /
Function (curated) metabolism carbon Calvin cycle
Localization (curated) Ch/S & Ch/Th & Ch/E
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
MASSTATMLK 1,097.50966 0.31 35.2 1
GLVPLVGSYDESWCQGLDGLASR 2,469.14812 0.59 61.1 1
AASAYADELVK 1,136.57130 0.30 27.8 1
KMVDVLVEQNIVPGIK 1,797.00693 0.39 76.6 3
MVDVLVEQNIVPGIK 1,652.91705 0.49 84.7 8
MVDVLVEQNIVPGIKVDK 2,011.10228 0.41 41.5 1
PSMVTPGAEATDR 1,330.61868 0.23 63.9 1
TYDVAEK 824.39157 0.17 48.3 13
AAQDILLAR 969.56070 0.32 75.9 70
TVVSIPNGPSALAVK 1,451.83472 0.38 78.2 98
LASIGLENTEANR 1,386.71025 0.30 102 89
MVDVLVEQNIVPGIK 1,684.90689 0.45 103.9 65
EAAWGLAR 872.45041 0.32 63.2 25
TLLVSAPGLGQYISGAILFEETLYQSTTDGKK 3,399.78125 0.66 63.3 1
PSMVTPGAEATDR 1,362.60852 0.21 72.9 5
TIASPGHGIMAMDESNATCGK 2,185.89253 0.26 100.6 3
MVDVLVEQNIVPGIKVDK 1,995.10736 0.48 68.7 2
TIASPGHGIMAMDESNATCGKR 2,357.98856 0.24 130 11
RLASIGLENTEANR 1,542.81136 0.27 97.8 4
ATPEQVASYTLK 1,306.67685 0.33 85.7 41
YTGEGESEEAK 1,198.49892 0.14 81.2 78
KMVDVLVEQNIVPGIK 1,781.01201 0.43 35.7 1
TIASPGHGIMAMDESNATCGK 2,201.88745 0.27 113.6 7
ANSLAQLGK 900.50284 0.25 77.1 76
TAAYYQQGAR 1,127.53593 0.20 68.5 51
YAAISQDSGLVPIVEPEIMLDGEHGIDR 3,039.48582 0.49 100.3 7
TWGGKEENVK 1,146.56688 0.16 45.2 4
KMVDVLVEQNIVPGIKVDK 2,155.19215 0.38 56.2 2
AKANSLAQLGK 1,099.63490 0.20 93.3 70
ALQNTCLK 937.45386 0.22 66.9 30
MVDVLVEQNIVPGIKVDK 2,027.09720 0.42 105.3 21
ALQNTCLK 889.46912 0.26 38.5 1
PSMVTPGAEATDR 1,346.61360 0.20 47.5 3
YAAISQDSGLVPIVEPEIMLDGEHGIDR 3,055.48074 0.49 139.1 13
YAAISQDSGLVPIVEPEIMLDGEHGIDR 3,023.49091 0.53 102.2 2
KMVDVLVEQNIVPGIK 1,813.00185 0.40 124.9 21
MVDVLVEQNIVPGIK 1,668.91197 0.45 117.3 29
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 14.72 16.53 68.75 827 STR-THY
Reference of the experiment Reference date Sample CAM Binding Protein
cam_bp 2013-01-01 00:00:00 CET Arabidopsis_stroma;Spinach_stroma_env;
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 2.85836 0 LAM_high