last update : january 2015

Public data retrieved in 2014



Home

AT2G21330 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT2G21330
Master Protein AT2G21330.1
Description (curated) fructose-bisphosphate aldolase, putative
Calculated MW (PPDB) 42.93
Calculated PI (PPDB) 6.17
Length 399
Curated Annotation
Description (curated) FBA1 (SFBA-1, ALFC1) fructose bisphosphate aldolase 1, chloroplast precursor /
Function (curated) metabolism carbon Calvin cycle
Localization (curated) Ch/S & Ch/Th & Ch/E
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
AAQDILLAR 969.56070 0.32 75.9 70
TIASPGHGIMAMDESNATCGK 2,201.88745 0.27 113.6 7
TLLVSAPGLGQYISGAILFEETLYQSTTDGKK 3,399.78125 0.66 63.3 1
PSMVTPGAEATDR 1,330.61868 0.23 63.9 1
MVDVLVEQNIVPGIK 1,684.90689 0.45 103.9 65
ANSLAQLGK 900.50284 0.25 77.1 76
KMVDVLVEQNIVPGIK 1,781.01201 0.43 35.7 1
TYDVAEK 824.39157 0.17 48.3 13
TAAYYQQGAR 1,127.53593 0.20 68.5 51
GLVPLVGSYDESWCQGLDGLASR 2,469.14812 0.59 61.1 1
KMVDVLVEQNIVPGIK 1,797.00693 0.39 76.6 3
PSMVTPGAEATDR 1,346.61360 0.20 47.5 3
MVDVLVEQNIVPGIK 1,668.91197 0.45 117.3 29
YAAISQDSGLVPIVEPEIMLDGEHGIDR 3,039.48582 0.49 100.3 7
YTGEGESEEAK 1,198.49892 0.14 81.2 78
LASIGLENTEANR 1,386.71025 0.30 102 89
TIASPGHGIMAMDESNATCGKR 2,357.98856 0.24 130 11
TIASPGHGIMAMDESNATCGK 2,185.89253 0.26 100.6 3
ALQNTCLK 889.46912 0.26 38.5 1
RLASIGLENTEANR 1,542.81136 0.27 97.8 4
MVDVLVEQNIVPGIKVDK 2,027.09720 0.42 105.3 21
ALQNTCLK 937.45386 0.22 66.9 30
KMVDVLVEQNIVPGIK 1,813.00185 0.40 124.9 21
MASSTATMLK 1,097.50966 0.31 35.2 1
ATPEQVASYTLK 1,306.67685 0.33 85.7 41
MVDVLVEQNIVPGIKVDK 1,995.10736 0.48 68.7 2
MVDVLVEQNIVPGIKVDK 2,011.10228 0.41 41.5 1
EAAWGLAR 872.45041 0.32 63.2 25
YAAISQDSGLVPIVEPEIMLDGEHGIDR 3,055.48074 0.49 139.1 13
TWGGKEENVK 1,146.56688 0.16 45.2 4
TVVSIPNGPSALAVK 1,451.83472 0.38 78.2 98
AKANSLAQLGK 1,099.63490 0.20 93.3 70
KMVDVLVEQNIVPGIKVDK 2,155.19215 0.38 56.2 2
MVDVLVEQNIVPGIK 1,652.91705 0.49 84.7 8
YAAISQDSGLVPIVEPEIMLDGEHGIDR 3,023.49091 0.53 102.2 2
PSMVTPGAEATDR 1,362.60852 0.21 72.9 5
AASAYADELVK 1,136.57130 0.30 27.8 1
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 14.72 16.53 68.75 827 STR-THY
Reference of the experiment Reference date Sample CAM Binding Protein
cam_bp 2013-01-01 00:00:00 CET Arabidopsis_stroma;Spinach_stroma_env;
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 2.85836 0 LAM_high