last update : january 2015

Public data retrieved in 2014



Home

AT1G63940 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT1G63940
Master Protein AT1G63940.1
Description (curated) monodehydroascorbate reductase, putative
Calculated MW (PPDB) 52.5
Calculated PI (PPDB) 7.05
Length 486
Curated Annotation
Description (curated) MDAR Monodehydroascorbate reductase
Function (curated) redox
Localization (curated) Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
TFVENGMADGRLCIVTK 1,932.89204 0.39 88.3 2
LKGVLVESGSPEEFQLLPK 2,069.14076 0.44 116.1 3
GASINNLEAGSDGR 1,359.63780 0.26 111.8 32
SQPLVDKAK 984.56036 0.15 39.4 1
RSAQHCVK 975.45558 0.05 50.7 1
VEHVDHARR 1,117.57405 0.07 34.8 1
PAIGPFETLAMNK 1,403.71184 0.41 72.3 5
EAYAPYER 997.45047 0.24 27.4 1
SQPLVDK 785.42830 0.16 43.4 1
LASASSVEEALEIAQAALQS 1,987.01090 0.67 103.8 53
GVLVESGSPEEFQLLPK 1,827.96175 0.51 135 13
LFTPSLAQKYEELYR 1,856.96719 0.44 34.6 1
EAYAPYERPALTK 1,507.76704 0.28 59.1 2
YGSLIIATGCTASRFPDK 1,946.94072 0.41 48.3 1
GIEVIYEDPVAGADFEK 1,850.89372 0.50 98.8 14
LPGFHTCVGGGGER 1,433.63568 0.31 63.7 7
LADGSTIEADTVVIGIGAK 1,828.97813 0.44 98.8 8
LADGSTIEADTVVIGIGAKPAIGPFETLAMNK 3,230.67433 0.53 142.3 2
VEHVDHAR 961.47295 0.08 46 13
PAIGPFETLAMNK 1,419.70676 0.43 69.7 6
PAIGPFETLAMNK 1,387.71692 0.45 62.4 1
QTLTTDAGK 933.47672 0.14 59 7
EVADADSLIASLGK 1,387.71942 0.46 100.4 36
SIGGIQVDGLFR 1,260.68257 0.46 83.4 27
TFVENGMADGR 1,227.51895 0.23 72.6 3
EFVIVGGGNAAGYAAR 1,550.78403 0.38 139.8 12
VFEYEGSPR 1,082.50322 0.27 53.1 30
TSTPGIFAIGDVAAFPLK 1,803.97702 0.56 97.6 42
IATFWIESGR 1,178.60837 0.44 90.9 9
LFTPSLAQK 1,003.57021 0.33 41.8 5
EKGIEVIYEDPVAGADFEK 2,108.03126 0.42 80.2 1
IGGHLPGVHYIR 1,317.73053 0.29 42.6 4
GIEVIYEDPVAGADFEKQTLTTDAGK 2,766.35988 0.46 70.9 2
TFVENGMADGR 1,211.52403 0.22 59.4 3
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 0 0 100 342 STR
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 0 1 -