last update : january 2015

Public data retrieved in 2014



Home

AT1G63770 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT1G63770
Master Protein AT1G63770.2
Description (curated) peptidase M1 family protein
Calculated MW (PPDB) 106.1
Calculated PI (PPDB) 6.11
Length 945
Curated Annotation
Description (curated)
Function (curated)
Localization (curated)
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
FVQGLGSVLSDSSLDKEFIAK 2,239.17352 0.47 45.2 2
GIDLYFER 1,011.50250 0.41 51.9 2
IWTPAEDLPK 1,168.61281 0.42 38 2
HDEQAVTCEDFFAAMR 1,948.75670 0.40 110.9 1
QLASELKEELLK 1,399.79219 0.38 69.8 2
DQEFSSDMGSR 1,273.48807 0.19 59.8 1
STEAYVFDHSNMAR 1,642.70453 0.27 55.2 2
TAHAMYSLK 1,052.49606 0.20 36.5 1
FLGDIVVQLDK 1,245.69684 0.48 80.6 5
KLLDHPAFDLR 1,323.72989 0.33 29.7 1
KGIDLYFER 1,139.59746 0.35 36.1 2
DQEFSSDMGSR 1,289.48299 0.20 78.6 8
FSQEIPPTPGQPTK 1,525.77763 0.28 52.6 2
DDTFTTR 854.37701 0.20 39.7 4
LVLASPETATDADYAAILGVIGHEYFHNWTGNR 3,600.76364 0.64 35.2 1
TRDDILADFYNK 1,469.71503 0.40 58.6 1
VVSSYNADAR 1,080.51994 0.18 75.9 7
LLDHPAFDLR 1,195.63493 0.36 52.5 3
EGDYQLDSR 1,081.46759 0.23 67 8
STEAYVFDHSNMAR 1,658.69945 0.29 72.1 2
TLLGTQGFRK 1,119.64000 0.27 44.9 3
EGLTVFRDQEFSSDMGSR 2,091.91669 0.37 67.8 2
SSGNFCTQCEAEGFR 1,730.61476 0.38 50.5 1
KQLASELKEELLK 1,527.88715 0.34 75.2 4
LLKEGDYQLDSR 1,435.73067 0.28 86.4 2
FVQGLGSVLSDSSLDK 1,650.84640 0.45 140.4 3
TLLGTQGFR 991.54504 0.34 54.7 5
LLSVKVEGK 971.60147 0.24 45.6 1
VKGSSAALVLDGHDLK 1,608.88345 0.29 98 4
ITFYQDRPDIMAK 1,628.78682 0.33 68.1 2
DDILADFYNK 1,212.56624 0.47 49.6 1
MATNLTDQFAALAALSQNPGK 2,193.07353 0.52 94.1 1
VETDLSNDDLFFLLAHDSDEFNR 2,711.23505 0.58 32.8 1
EPTFIPVVVGLLDSSGK 1,756.96103 0.63 82.7 8
SLNIFNSK 921.49194 0.35 50.2 2
SSGNFCTQCEAEGFRK 1,858.70972 0.32 84.1 2
WEAGQVLAR 1,028.54028 0.32 44.8 1
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 0 0 100 96 STR