last update : january 2015

Public data retrieved in 2014



Home

AT1G62750 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT1G62750
Master Protein AT1G62750.1
Description (curated) ATSCO1/ATSCO1/CPEF-G/SCO1 (SNOWY COTYLEDON1); translation elongation factor/ translation factor, nucleic acid binding
Calculated MW (PPDB) 86.05
Calculated PI (PPDB) 5.43
Length 783
Curated Annotation
Description (curated) EF-Tu-G (EF-G, SCO1) elongation factor G, chloroplast precursor /
Function (curated) translation stroma
Localization (curated) Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
DMIVTNLGAKPLVLQIPIGAEDVFK 2,712.47710 0.55 51.4 1
IMSDPFVGSLTFVR 1,583.80171 0.51 89.3 5
IMSDPFVGSLTFVR 1,599.79663 0.49 131.9 30
FEPLEAGSGYEFK 1,472.68228 0.41 92.7 7
MDFPDPVIK 1,060.52629 0.40 33.9 1
KQSGGQGQFADITVR 1,590.81136 0.28 108.1 2
DTITGETLSDPENPVVLER 2,084.02730 0.42 88.5 12
VVDSLVPLAEMFQYVSTLR 2,182.13432 0.62 64.6 2
VVDSLVPLAEMFQYVSTLR 2,198.12924 0.62 70.6 18
NIGIMAHIDAGK 1,238.64409 0.31 45.2 1
MATGLIK 764.41020 0.22 41.4 5
GQINSFGDKPGGLK 1,416.73605 0.26 77.3 7
MLEPIMR 888.45610 0.36 34.9 1
KPDDDEPFAGLAFK 1,548.74597 0.41 95.8 49
ICFVNKMDR 1,204.52161 0.29 54 11
TKADIDK 789.42322 0.05 38.5 2
NIGIMAHIDAGK 1,254.63901 0.27 30 1
LLEMHANSREDVK 1,572.75656 0.17 54.7 4
PLVLQIPIGAEDVFK 1,637.93918 0.56 78.4 24
AAMMELIVDLDDEVMENYLEGVEPDEATVKR 3,619.61023 0.56 83.2 1
FDVVPQHIQNQLSSK 1,738.90019 0.35 75.4 8
MDFPDPVIK 1,076.52121 0.35 62 6
QSGGQGQFADITVR 1,462.71640 0.32 95.6 29
INIIDTPGHVDFTLEVER 2,067.06361 0.45 45.7 1
RGQINSFGDKPGGLK 1,572.83716 0.22 86.1 29
VVDSLVPLAEMFQYVSTLR 2,166.13940 0.72 111.3 3
IMSDPFVGSLTFVR 1,567.80679 0.54 75.2 4
LGANFFR 823.43402 0.35 60.4 30
VALTGDIIALAGLK 1,353.82309 0.54 108.8 9
DMIVTNLGAK 1,076.55356 0.27 36.9 1
VALTGDIIALAGLKDTITGETLSDPENPVVLER 3,419.83983 0.57 79.5 3
NIGIMAHIDAGK 1,270.63393 0.27 61.8 2
ADIDKMATGLIK 1,306.68022 0.30 43 2
MDFPDPVIK 1,092.51613 0.37 48 19
GVVDLVR 756.44934 0.31 43.9 2
FVPILCGSAFK 1,228.61614 0.52 64.1 20
KGTITGK 703.42281 0.06 53.6 4
MLEPIMR 952.43578 0.27 35.7 4
TRDMIVTNLGAK 1,349.69727 0.26 67.9 3
ILYYTGR 884.47557 0.28 26.4 1
LLEMHANSR 1,101.52367 0.15 71.8 34
VEVVTPEEHLGDVIGDLNSR 2,177.09634 0.45 64.5 9
RAVPLKDYR 1,116.64034 0.19 24.3 1
DMIVTNLGAK 1,092.54848 0.29 69.2 6
LAQEDPSFHFSR 1,432.67349 0.31 77.3 8
LLEMHANSR 1,085.52875 0.14 50.6 5
ASYTMQLAK 1,043.49573 0.23 38.8 1
VEANVGAPQVNYR 1,415.71565 0.28 81.7 11
AIVWSGEELGAK 1,258.65568 0.39 61.8 8
FSYEDIPEDLEDLAQEYR 2,230.99057 0.63 102.3 12
ISAGSYVLNANK 1,235.65094 0.31 106.1 24
LLEMHANSR 1,069.53383 0.19 50.9 1
ASYTMQLAK 1,027.50081 0.22 25.8 2
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 1.1 0 98.9 469 STR
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 0.33333 0.24292 -