last update : january 2015

Public data retrieved in 2014



Home

AT1G61520 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT1G61520
Master Protein AT1G61520.1
Description (curated) LHCA3 (Photosystem I light harvesting complex gene 3); chlorophyll binding
Calculated MW (PPDB) 29.18
Calculated PI (PPDB) 8.61
Length 273
Curated Annotation
Description (curated) LHCA3 (LHCI-3, CAB4) photosystem I light harvesting complex gene A3, chlorophyll A-B binding protein, chloroplast precursor /
Function (curated) PS LHCI
Localization (curated) Ch/Th
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
QGANRPLWFASSQSLSYLDGSLPGDYGFDPLGLSDPEGTGGFIEPR 4,870.31494 0.63 117.8 1
WLAYGEIINGRFAMLGAAGAIAPEILGK 2,917.55228 0.58 30.6 1
RLQDWYNPGSMGK 1,566.72487 0.31 56.8 3
FAMLGAAGAIAPEILGK 1,644.89082 0.49 133.4 48
GLAGSGNPAYPGGPFFNPLGFGKDEK 2,593.26000 0.49 95.5 49
FAMLGAAGAIAPEILGK 1,660.88574 0.51 136.7 169
LQDWYNPGSMGK 1,410.62376 0.33 78.7 7
LAMLAILGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLK 4,426.36090 0.82 83.1 1
QYFLGLEK 996.52798 0.39 45.9 15
RLQDWYNPGSMGK 1,582.71979 0.32 77.3 4
GLAGSGNPAYPGGPFFNPLGFGK 2,221.09550 0.56 127.1 20
LQDWYNPGSMGK 1,426.61868 0.33 71.3 6
WLAYGEIINGR 1,290.67201 0.48 80.7 13
LQDWYNPGSMGK 1,394.62884 0.37 57.7 4
ELKLKEVK 985.61713 0.18 37.8 3
LAMLAILGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLK 4,410.36598 0.81 75.1 2
FAMLGAAGAIAPEILGK 1,628.89590 0.53 130.5 7
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 7.97 92.03 0 346 THY
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 1.89645 0 LAM_high