last update : january 2015

Public data retrieved in 2014



Home

AT1G52230 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT1G52230
Master Protein AT1G52230.1
Description (curated) PSAH-2/PSAH2/PSI-H (PHOTOSYSTEM I SUBUNIT H-2)
Calculated MW (PPDB) 15.27
Calculated PI (PPDB) 9.89
Length 145
Curated Annotation
Description (curated) PSAH-2 Photosystem I reaction center subunit VI-2, chloroplast precursor /
Function (curated) PS PSI
Localization (curated) Ch/Th
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
FFETFAAPFTK 1,304.64407 0.50 92.5 64
SVYFDLEDLGNTTGQWDVYGSDAPSPYNPLQSK 3,662.66882 0.59 159.4 2
FLILGGGSLLTYVSANSTGDVLPIK 2,534.39949 0.62 150.5 3
RGPQEPPKLGPR 1,330.74692 0.17 66 4
RGPQEPPK 907.48753 0.08 48.4 1
GPQEPPK 751.38643 0.12 55.9 39
FFETFAAPFTKR 1,460.74518 0.43 67.5 28
GPQEPPKLGPR 1,174.64581 0.21 70.3 111
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 2.62 97.17 0.21 246 THY
Reference of the experiment Reference date Sample CAM Binding Protein
cam_bp 2013-01-01 00:00:00 CET Arabidopsis_membranes;
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 3.40155 0 LAM_high