last update : january 2015

Public data retrieved in 2014



Home

AT1G32060 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT1G32060
Master Protein AT1G32060.1
Description (curated) PRK (PHOSPHORIBULOKINASE); ATP binding / phosphoribulokinase/ protein binding
Calculated MW (PPDB) 44.46
Calculated PI (PPDB) 5.7
Length 395
Curated Annotation
Description (curated) PRK2 (KPPR, PRKASE) phosphoribulokinase 2, phosphopentokinase, chloroplast precursor (EC 2.7.1.19) /
Function (curated) metabolism carbon Calvin cycle
Localization (curated) Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
FYGEVTQQMLK 1,358.65399 0.31 89.5 18
FYGEVTQQMLK 1,342.65907 0.39 71.9 7
ANDFDLMYEQVK 1,503.65512 0.37 92.7 77
GHSLESIK 869.46065 0.18 50.5 24
FNYEPDSYFDHEVSVLEMDGQFDR 2,954.23404 0.55 92.7 9
KPDFDAFIDPQKQYADAVIEVLPTTLIPDDNEGK 3,801.89882 0.56 30.6 1
IRDLYEQLIANK 1,474.81433 0.39 74.8 73
HADFPGSNNGTGLFQTIVGLK 2,172.09628 0.49 154.9 9
FNYEPDSYFDHEVSVLEMDGQFDR 2,970.22896 0.56 79.5 5
VTALDPR 770.42864 0.20 54.5 61
ILVIEGLHPMFDER 1,683.86537 0.42 83.3 29
DLYEQLIANK 1,205.62917 0.44 75.1 28
FYGEVTQQMLK 1,374.64891 0.32 80.9 56
ANDFDLMYEQVK 1,471.66528 0.44 87 4
ILVIEGLHPMFDER 1,667.87045 0.48 76.9 7
FNYEPDSYFDHEVSVLEMDGQFDR 2,938.23912 0.54 79.1 2
NGIAVEKPIYNHVTGLLDPPELIQPPK 2,951.61195 0.46 72.1 13
GGNPDSNTLISDTTTVICLDDYHSLDR 2,969.31961 0.50 161.9 4
QYADAVIEVLPTTLIPDDNEGK 2,400.20598 0.54 119.1 37
YFSPVYLFDEGSTISWIPCGR 2,484.13069 0.69 43.7 1
KLTCSYPGIK 1,156.57977 0.28 60.4 18
LDELIYVESHLSNLSTK 1,960.01527 0.49 104.8 28
ANDFDLMYEQVK 1,487.66020 0.37 96.8 20
LIMKEGVK 948.53136 0.14 43.8 2
LTSVFGGAAKPPK 1,271.72371 0.27 95.2 91
LTCSYPGIK 1,028.48482 0.31 30.2 2
KPDFDAFIDPQK 1,419.70340 0.37 89.9 75
RLTSVFGGAAKPPK 1,427.82481 0.25 73.5 32
ILVIEGLHPMFDER 1,699.86029 0.43 85.9 87
NGIAVEK 729.40205 0.18 35.9 1
GGNPDSNTLISDTTTVICLDDYHSLDR 2,921.33487 0.55 86.3 1
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 14.22 2.11 83.67 794 STR
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 1.73208 0 LAM_high