last update : january 2015

Public data retrieved in 2014



Home

AT1G32060 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT1G32060
Master Protein AT1G32060.1
Description (curated) PRK (PHOSPHORIBULOKINASE); ATP binding / phosphoribulokinase/ protein binding
Calculated MW (PPDB) 44.46
Calculated PI (PPDB) 5.7
Length 395
Curated Annotation
Description (curated) PRK2 (KPPR, PRKASE) phosphoribulokinase 2, phosphopentokinase, chloroplast precursor (EC 2.7.1.19) /
Function (curated) metabolism carbon Calvin cycle
Localization (curated) Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
KPDFDAFIDPQK 1,419.70340 0.37 89.9 75
ANDFDLMYEQVK 1,503.65512 0.37 92.7 77
GHSLESIK 869.46065 0.18 50.5 24
DLYEQLIANK 1,205.62917 0.44 75.1 28
VTALDPR 770.42864 0.20 54.5 61
NGIAVEKPIYNHVTGLLDPPELIQPPK 2,951.61195 0.46 72.1 13
FYGEVTQQMLK 1,374.64891 0.32 80.9 56
ANDFDLMYEQVK 1,471.66528 0.44 87 4
GGNPDSNTLISDTTTVICLDDYHSLDR 2,921.33487 0.55 86.3 1
IRDLYEQLIANK 1,474.81433 0.39 74.8 73
ILVIEGLHPMFDER 1,683.86537 0.42 83.3 29
FNYEPDSYFDHEVSVLEMDGQFDR 2,938.23912 0.54 79.1 2
ANDFDLMYEQVK 1,487.66020 0.37 96.8 20
KLTCSYPGIK 1,156.57977 0.28 60.4 18
LDELIYVESHLSNLSTK 1,960.01527 0.49 104.8 28
LIMKEGVK 948.53136 0.14 43.8 2
FYGEVTQQMLK 1,342.65907 0.39 71.9 7
NGIAVEK 729.40205 0.18 35.9 1
QYADAVIEVLPTTLIPDDNEGK 2,400.20598 0.54 119.1 37
ILVIEGLHPMFDER 1,699.86029 0.43 85.9 87
LTCSYPGIK 1,028.48482 0.31 30.2 2
RLTSVFGGAAKPPK 1,427.82481 0.25 73.5 32
FNYEPDSYFDHEVSVLEMDGQFDR 2,954.23404 0.55 92.7 9
HADFPGSNNGTGLFQTIVGLK 2,172.09628 0.49 154.9 9
KPDFDAFIDPQKQYADAVIEVLPTTLIPDDNEGK 3,801.89882 0.56 30.6 1
YFSPVYLFDEGSTISWIPCGR 2,484.13069 0.69 43.7 1
ILVIEGLHPMFDER 1,667.87045 0.48 76.9 7
FYGEVTQQMLK 1,358.65399 0.31 89.5 18
GGNPDSNTLISDTTTVICLDDYHSLDR 2,969.31961 0.50 161.9 4
LTSVFGGAAKPPK 1,271.72371 0.27 95.2 91
FNYEPDSYFDHEVSVLEMDGQFDR 2,970.22896 0.56 79.5 5
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 14.22 2.11 83.67 794 STR
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 1.73208 0 LAM_high