last update : january 2015

Public data retrieved in 2014



Home

AT1G29910 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT1G29910
Master Protein AT1G29910.1
Description (curated) CAB3 (CHLOROPHYLL A/B BINDING PROTEIN 3); chlorophyll binding
Calculated MW (PPDB) 28.22
Calculated PI (PPDB) 5.28
Length 267
Curated Annotation
Description (curated) LHCII-1.1 chlorophyll A-B binding protein 165/180, chloroplast precursor /
Function (curated) PS LHC
Localization (curated) Ch/Th & other
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
LAMFSMFGFFVQAIVTGK 2,041.00520 0.73 133.1 109
VKELKNGR 942.56100 0.06 41.4 3
WAMLGALGCVFPELLAR 1,861.95821 0.63 109.7 4
YLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAR 3,956.76923 0.61 187.1 14
LAMFSMFGFFVQAIVTGK 2,057.00012 0.70 153.6 88
LAMFSMFGFFVQAIVTGK 2,025.01028 0.70 133.7 85
LAMFSMFGFFVQAIVTGK 2,009.01537 0.72 86.9 3
KTVAKPK 770.50139 0.06 38 1
PKGPSGSPWYGSDR 1,489.69495 0.25 69.4 2
NRELEVIHSR 1,251.66834 0.24 68.6 441
GPSGSPWYGSDR 1,264.54723 0.29 83 45
WAMLGALGCVFPELLAR 1,925.93787 0.68 82.9 6
WAMLGALGCVFPELLAR 1,909.94295 0.67 118.6 7
AVNLSPAASEVLGSGR 1,526.80519 0.38 75.6 5
NGVKFGEAVWFK 1,380.71893 0.42 51.9 3
VAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVK 3,856.94093 0.63 200.3 5
VAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELK 3,629.77757 0.74 105.5 42
FGEAVWFK 982.49120 0.48 61.9 40
GPIENLADHLADPVNNNAWAFATNFVPGK 3,091.51508 0.58 115.2 17
VKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAR 4,183.93259 0.58 158.8 3
ELEVIHSR 981.52431 0.22 62.2 147
GPSGSPWYGSDRVK 1,491.71059 0.26 78.1 2
LAMFSMFGFFVQAIVTGK 1,993.02045 0.69 36.2 2
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 1.33 98 0.68 1,047 THY