last update : january 2015

Public data retrieved in 2014



Home

AT1G29900 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT1G29900
Master Protein AT1G29900.1
Description (curated) CARB (CARBAMOYL PHOSPHATE SYNTHETASE B); ATP binding / carbamoyl-phosphate synthase
Calculated MW (PPDB) 129.95
Calculated PI (PPDB) 5.53
Length 1,187
Curated Annotation
Description (curated)
Function (curated)
Localization (curated)
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
FPGSQPLLTTQMK 1,478.74390 0.33 33.5 1
LITYLENAVQVDPERPVLVDK 2,410.31070 0.45 84.6 8
TTEEEVR 862.40320 0.11 30 1
AMEIVYDDSR 1,229.52339 0.26 76.4 18
FNAILDELKIEQPK 1,656.90862 0.43 66.2 8
VLILGGGPNR 994.59230 0.31 42.9 20
VPVITTVAGALATAEGIK 1,709.99266 0.53 120.1 12
ERPDALLPTMGGQTALNLAVALAESGALEK 3,067.58586 0.59 80.2 1
IGEFPLIIR 1,056.63312 0.46 46.2 5
FNAILDELK 1,061.57567 0.42 30.5 2
IVATSGTAHFLELK 1,485.81908 0.36 49.1 3
SEADALAIAK 987.52364 0.28 49.7 5
LSVGYTLDQIPNDITR 1,803.93665 0.45 53 1
QIAFATK 777.43846 0.24 39.9 2
IAVSFLELGFK 1,222.69609 0.52 83 9
MTALQDFFEVK 1,359.63802 0.49 74.5 4
SVGESMALGR 1,037.48111 0.21 55.5 15
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 0 0 100 101 STR
Reference of the experiment Reference date Sample CAM Binding Protein
cam_bp 2013-01-01 00:00:00 CET Arabidopsis_membranes;