last update : january 2015

Public data retrieved in 2014



Home

ATCG00730 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein ATCG00730
Master Protein AtCg00730
Description (curated) A chloroplast gene encoding subunit IV of the cytochrome b6/f complex
Calculated MW (PPDB) 17.43
Calculated PI (PPDB) 6.55
Length 160
Curated Annotation
Description (curated) PETD subunit IV of the b6/f complex, chloroplast encoded /
Function (curated) PS b6-F
Localization (curated) Ch/Th
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
GVTKKPDLNDPVLR 1,550.87799 0.25 71.2 19
KPDLNDPVLR 1,165.64549 0.26 72.2 148
TVPNKLLGVLLMVSVPAGLLTVPFLENVNK 3,190.84020 0.69 44.8 2
RPVATTVFLIGTAAALWLGIGATLPIDK 2,864.65270 0.74 43.5 3
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 4.08 95.92 0 159 THY
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 2.61455 0.00191 LAM_high