last update : january 2015
Public data retrieved in 2014
ATCG00730 protein group
Protein ATCG00730
|
Master Protein |
AtCg00730 |
Description (curated) |
A chloroplast gene encoding subunit IV of the cytochrome b6/f complex |
Calculated MW (PPDB) |
17.43 |
Calculated PI (PPDB) |
6.55 |
Length |
160 |
|
Curated Annotation
|
Description (curated) |
PETD subunit IV of the b6/f complex, chloroplast encoded / |
Function (curated) |
PS b6-F |
Localization (curated) |
Ch/Th |
Localization (validated) |
Yes
|
References |
|
Curated Protein Name |
|
Publication (PPDB) |
|
|
Peptides
|
Sequence |
Monoisotopic mass |
Retention Time |
Score |
Observed MS/MS count |
KPDLNDPVLR |
1,165.64549 |
0.26 |
72.2 |
148 |
TVPNKLLGVLLMVSVPAGLLTVPFLENVNK |
3,190.84020 |
0.69 |
44.8 |
2 |
GVTKKPDLNDPVLR |
1,550.87799 |
0.25 |
71.2 |
19 |
RPVATTVFLIGTAAALWLGIGATLPIDK |
2,864.65270 |
0.74 |
43.5 |
3 |
Reference of the experiment |
Reference date |
score % of enveloppe |
score % of thylakoïd |
score % of stroma |
Total spectral count |
Localization Score |
at_chloro_v1 |
2010 06 |
4.08 |
95.92 |
0 |
159 |
THY |
Reference of the experiment |
Reference date |
Log Fold Change |
pValue |
Curated Protein Complex Classes |
Differentially distributed proteins high or medium |
thylakoïd_sub_compartments |
2013-10-01 00:00:00 CEST |
2.61455 |
0.00191 |
|
LAM_high |