last update : january 2015

Public data retrieved in 2014



Home

ATCG00680 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein ATCG00680
Master Protein AtCg00680
Description (curated) encodes for CP47, subunit of the photosystem II reaction center.
Calculated MW (PPDB) 56.03
Calculated PI (PPDB) 6.39
Length 508
Curated Annotation
Description (curated) PSBB (CP47) subunit of the photosystem II reaction center, chloroplast encoded /
Function (curated) PS PSII
Localization (curated) Ch/Th
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
QGMFVIPFMTR 1,341.65730 0.49 31.9 2
AGSMDNGDGIAVGWLGHPVFR 2,171.02173 0.47 111.9 10
LGDPTTKR 886.48721 0.13 63 38
VSAGLAENQSLSEAWAK 1,759.87401 0.38 82.9 13
RAQLGEIFELDR 1,445.76262 0.41 84.5 59
RMPTFFETFPVVLVDGDGIVR 2,394.24049 0.61 89.3 4
MPTFFETFPVVLVDGDGIVR 2,238.13939 0.67 112.2 2
TGKPSLDLPK 1,054.60223 0.26 42.8 29
MPTFFETFPVVLVDGDGIVRADVPFRR 3,095.59015 0.59 49.2 2
AQLGEIFELDRATLKSDGVFR 2,364.24367 0.49 57.3 2
NKEGRELFVR 1,246.67815 0.22 39.6 2
ATLKSDGVFR 1,092.59271 0.25 66.5 19
QGMFVIPFMTR 1,373.64714 0.45 70.8 28
YQWDQGYFQQEIYR 1,922.85872 0.47 106.6 5
ADVPFRR 859.46640 0.21 26.5 2
MPTFFETFPVVLVDGDGIVRADVPFR 2,939.48904 0.63 70.8 1
RVSAGLAENQSLSEAWAKIPEK 2,383.24948 0.39 76.4 1
MPTFFETFPVVLVDGDGIVR 2,254.13431 0.61 112.3 15
AGSMDNGDGIAVGWLGHPVFR 2,155.02681 0.49 107.4 2
LGDPTTK 730.38611 0.13 54.3 19
QGMFVIPFMTR 1,325.66238 0.56 48.2 2
RMPTFFETFPVVLVDGDGIVRADVPFR 3,095.59015 0.59 40 1
QGMFVIPFMTR 1,389.64206 0.48 71 65
AQLGEIFELDRATLK 1,702.92532 0.46 90.3 38
RMPTFFETFPVVLVDGDGIVR 2,410.23541 0.57 101.7 10
VSAGLAENQSLSEAWAKIPEKLAFYDYIGNNPAK 3,693.86774 0.55 24.8 1
YQWDQGYFQQEIYRR 2,078.95982 0.44 49.8 2
PSLDLPK 768.43814 0.29 51.4 5
RMPTFFETFPVVLVDGDGIVR 2,426.23033 0.58 83.9 25
IPEKLAFYDYIGNNPAK 1,952.00429 0.43 103.6 4
VHTVVLNDPGR 1,205.65163 0.23 78.5 50
VSAGLAENQSLSEAWAKIPEK 2,227.14838 0.43 43.3 2
LAFYDYIGNNPAK 1,484.72992 0.44 96.2 47
DVFAGIDPDLDAQVEFGAFQK 2,281.09020 0.58 130.9 19
AGSMDNGDGIAVGWLGHPVFR 2,187.01665 0.45 109.7 3
RAQLGEIFELDRATLK 1,859.02643 0.42 60.7 30
AQLGEIFELDR 1,289.66151 0.47 97.5 53
MPTFFETFPVVLVDGDGIVR 2,270.12923 0.64 126 18
QGMFVIPFMTR 1,357.65222 0.43 62 20
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST -1.99618 0 BBY_high
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 1.51 98.49 0 604 THY