last update : january 2015
Public data retrieved in 2014
See also | TAIR | PPDB | AtProteome | SUBA | POGs | Aramemnon |
|
|
Peptides | ||||
---|---|---|---|---|
Sequence | Monoisotopic mass | Retention Time | Score | Observed MS/MS count |
IPYDMQLK | 1,038.50557 | 0.29 | 30 | 1 |
GGYEITIVDASNGR | 1,450.70515 | 0.36 | 67.8 | 4 |
VQLSEMNF | 998.43787 | 0.40 | 60.8 | 40 |
VQLSEMNF | 966.44803 | 0.47 | 52.1 | 1 |
YPIYVGGNR | 1,037.52937 | 0.28 | 40.1 | 5 |
ISPEMKEK | 976.48990 | 0.10 | 38 | 3 |
GALNVGAVLILPEGFELAPPDR | 2,247.22621 | 0.59 | 85.7 | 12 |
EVIDIIPR | 953.55455 | 0.39 | 54.6 | 45 |
NILVIGPVPGQK | 1,233.74445 | 0.40 | 75.4 | 94 |
QVLANGKK | 856.51300 | 0.10 | 38.7 | 1 |
IVCANCHLANKPVDIEVPQTVLPDTVFEAVVK | 3,556.77920 | 0.56 | 52.4 | 1 |
YSEITFPILAPDPATNKDVHFLK | 2,615.36348 | 0.46 | 56.6 | 3 |
ISPEMKEK | 992.48482 | 0.10 | 46.2 | 19 |
IGNLSFQNYRPNKK | 1,677.89502 | 0.29 | 33.2 | 1 |
EKGGYEITIVDASNGR | 1,707.84270 | 0.32 | 110 | 4 |
GGYEITIVDASNGREVIDIIPR | 2,386.24915 | 0.50 | 62 | 1 |
GQIYPDGSK | 963.46612 | 0.18 | 37.2 | 1 |
KNILVIGPVPGQK | 1,361.83940 | 0.34 | 58.8 | 1 |
QVLANGK | 728.41804 | 0.11 | 35.3 | 2 |
SNNTVYNATAGGIISK | 1,608.81068 | 0.32 | 97.2 | 30 |
LDQPLTSNPNVGGFGQGDAEIVLQDPLR | 2,949.48312 | 0.50 | 61.5 | 1 |
GRGQIYPDGSK | 1,176.58868 | 0.17 | 47.7 | 4 |
GALNVGAVLILPEGFELAPPDRISPEMKEK | 3,189.71063 | 0.54 | 23.3 | 1 |
KGALNVGAVLILPEGFELAPPDR | 2,375.32117 | 0.54 | 37.5 | 3 |
YSEITFPILAPDPATNK | 1,875.96179 | 0.49 | 69.9 | 12 |
GALNVGAVLILPEGFELAPPDRISPEMKEK | 3,221.70047 | 0.51 | 110.1 | 4 |
VQLSEMNF | 982.44295 | 0.37 | 55.9 | 4 |
GLELLVSEGESIK | 1,372.74489 | 0.45 | 98.7 | 24 |
GALNVGAVLILPEGFELAPPDRISPEMKEK | 3,205.70555 | 0.53 | 62 | 3 |
Reference of the experiment | Reference date | score % of enveloppe | score % of thylakoïd | score % of stroma | Total spectral count | Localization Score |
---|---|---|---|---|---|---|
at_chloro_v1 | 2010 06 | 11.5 | 88.5 | 0 | 301 | THY |
Reference of the experiment | Reference date | Log Fold Change | pValue | Curated Protein Complex Classes | Differentially distributed proteins high or medium |
---|---|---|---|---|---|
thylakoïd_sub_compartments | 2013-10-01 00:00:00 CEST | 0.94002 | 0 | LAM_medium |