last update : january 2015

Public data retrieved in 2014



Home

ATCG00490 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein ATCG00490
Master Protein AtCg00490
Description (curated) large subunit of RUBISCO.
Calculated MW (PPDB) 52.95
Calculated PI (PPDB) 5.87
Length 479
Curated Annotation
Description (curated) RBL (RBCL) RuBisCO large subunit, chloroplast encoded (EC 4.1.1.39) /
Function (curated) metabolism carbon
Localization (curated) Ch
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
AMHAVIDRQK 1,199.60806 0.11 54.4 22
ESTLGFVDLLR 1,248.67136 0.54 88.5 252
LEGDRESTLGFVDLLR 1,818.94751 0.49 77.1 221
ELGVPIVMHDYLTGGFTANTSLSHYCRDNGLLLHIHR 4,229.04214 0.51 147.1 9
AGVKEYKLTYYTPEYETK 2,182.08333 0.33 105.9 2
FLFCAEAIYK 1,203.59976 0.51 73.4 4
DLAVEGNEIIR 1,227.64586 0.50 103.1 899
CYHIEPVPGEETQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFK 5,137.39275 0.81 131.1 6
AMHAVIDRQKNHGMHFR 2,047.01042 0.25 30.7 1
FLFCAEAIYKSQAETGEIK 2,195.04555 0.50 87.9 3
NHGMHFRVLAK 1,340.67712 0.22 57.7 1
EITFNFPTIDK 1,323.67104 0.47 65 84
LTYYTPEYETK 1,406.66054 0.34 70.9 194
CYHIEPVPGEETQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFK 5,121.39783 0.79 83.2 1
DLAVEGNEIIREACK 1,706.81444 0.37 118 66
SQAETGEIKGHYLNATAGTCEEMIK 2,760.22176 0.30 106.3 11
QKNHGMHFR 1,169.55121 0.10 40.1 10
ALRLSGGDHIHAGTVVGK 1,786.98013 0.27 85.7 7
AGVKEYK 793.43335 0.10 56.6 42
ALAALRLEDLR 1,239.72987 0.41 50.9 103
WSPELAAACEVWK 1,536.69183 0.52 72.3 5
VTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDR 3,853.86456 0.66 125 64
GGLDFTKDDENVNSQPFMR 2,200.96945 0.40 136.5 313
VLAKALR 769.51736 0.17 55.4 11
AVYECLRGGLDFTKDDENVNSQPFMR 3,083.35997 0.43 118.8 28
DNGLLLHIHR 1,186.65706 0.30 81.9 176
IPPAYTK 788.44322 0.19 44.4 34
WSPELAAACEVWK 1,488.70709 0.54 97.9 2
TFQGPPHGIQVERDK 1,707.86922 0.24 77.8 32
YGRPLLGCTIKPK 1,492.80713 0.29 64.5 98
DRFLFCAEAIYK 1,522.71256 0.49 114.1 57
NEGRDLAVEGNEIIREACK 2,163.02251 0.33 84 10
EACKWSPELAAACEVWK 1,919.89093 0.52 80.3 1
AMHAVIDRQKNHGMHFR 2,110.99010 0.19 51.2 3
AMHAVIDR 911.46469 0.18 56.5 12
AVYECLRGGLDFTK 1,618.76604 0.40 81.7 22
WSPELAAACEVWKEITFNFPTIDK 2,794.36757 0.72 81.5 2
ELGVPIVMHDYLTGGFTANTSLSHYCR 2,980.42107 0.54 135.1 4
SQAETGEIKGHYLNATAGTCEEMIKR 2,900.32794 0.26 79.1 3
DDYVEKDR 1,038.46178 0.15 59.5 146
FLFCAEAIYK 1,251.58450 0.55 61.5 119
NEGRDLAVEGNEIIR 1,683.85393 0.31 86.9 106
VALEACVQARNEGR 1,562.74702 0.25 94.2 18
GIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHP 6,368.16922 0.66 131.4 2
QKNHGMHFR 1,153.55629 0.19 32.9 1
DLAVEGNEIIREACKWSPELAAACEVWK 3,129.52623 0.70 32 1
QKNHGMHFR 1,185.54613 0.09 58.2 107
GGLDFTK 736.37552 0.27 57.8 56
GIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHP 6,352.17430 0.69 121.7 6
SQAETGEIKGHYLNATAGTCEEMIKR 2,916.32286 0.28 135.9 58
AMHAVIDR 943.45453 0.18 61.3 274
ASVGFKAGVKEYK 1,382.75571 0.24 31.6 1
EITFNFPTIDKLDGQE 1,865.90466 0.60 97.9 488
NHGMHFR 929.39259 0.11 40.6 41
SQAETGEIK 961.47160 0.15 71.3 190
GRCYHIEPVPGEETQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFK 5,350.51530 0.76 72.9 1
LSGGDHIHAGTVVGKLEGDRESTLGFVDLLR 3,247.69481 0.45 79.2 3
AMHAVIDR 927.45961 0.14 43.7 85
YGRPLLGCTIKPK 1,444.82239 0.32 58.8 10
ELGVPIVMHDYLTGGFTANTSLSHYCRDNGLLLHIHR 4,213.04723 0.45 97.3 5
ALAALRLEDLRIPPAYTK 2,010.16254 0.46 41.8 6
TFQGPPHGIQVER 1,464.74731 0.29 102.8 310
LTYYTPEYETKDTDILAAFR 2,409.17396 0.48 121.9 53
GGLDFTKDDENVNSQPFMR 2,184.97453 0.36 84.7 93
DTDILAAFR 1,020.52399 0.55 82.9 699
ELGVPIVMHDYLTGGFTANTSLSHYCR 3,060.39564 0.52 126.3 46
LSGGDHIHAGTVVGK 1,446.75786 0.22 99.6 263
LGLSAKNYGR 1,077.59303 0.24 71.2 12
NHGMHFR 913.39768 0.12 31.8 14
LSGGDHIHAGTVVGKLEGDR 2,017.03401 0.30 97.9 6
ESTLGFVDLLRDDYVEKDR 2,269.12257 0.49 110 124
YGRPLLGCTIK 1,267.65941 0.33 60 14
AMHAVIDRQKNHGMHFR 2,094.99518 0.18 28.9 1
EYKLTYYTPEYETK 1,826.86140 0.37 84.7 3
LEGDRESTLGFVDLLRDDYVEK 2,568.27068 0.48 61.9 39
TFQGPPHGIQVERDKLNK 2,063.09116 0.24 41.9 2
AVYECLRGGLDFTKDDENVNSQPFMR 3,067.36505 0.42 55 3
VALEACVQAR 1,058.55421 0.40 83.8 9
ELGVPIVMHDYLTGGFTANTSLSHYCR 3,044.40073 0.46 115.6 5
GGLDFTKDDENVNSQPFMR 2,168.97961 0.40 123.3 9
NHGMHFR 897.40276 0.14 37 7
LEDLRIPPAYTK 1,414.78198 0.34 68.2 73
ESTLGFVDLLRDDYVEK 1,997.99452 0.51 112.2 64
PLLGCTIKPK 1,068.63650 0.32 46.8 4
PLLGCTIKPK 1,116.62125 0.31 66.4 110
VALEACVQAR 1,106.53896 0.35 94.3 442
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 15.96 5.68 78.37 7,279 STR-ENV
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 2.60599 0 LAM_high