last update : january 2015

Public data retrieved in 2014



Home

ATCG00490 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein ATCG00490
Master Protein AtCg00490
Description (curated) large subunit of RUBISCO.
Calculated MW (PPDB) 52.95
Calculated PI (PPDB) 5.87
Length 479
Curated Annotation
Description (curated) RBL (RBCL) RuBisCO large subunit, chloroplast encoded (EC 4.1.1.39) /
Function (curated) metabolism carbon
Localization (curated) Ch
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
ALRLSGGDHIHAGTVVGK 1,786.98013 0.27 85.7 7
ELGVPIVMHDYLTGGFTANTSLSHYCR 3,044.40073 0.46 115.6 5
NEGRDLAVEGNEIIR 1,683.85393 0.31 86.9 106
GIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHP 6,368.16922 0.66 131.4 2
ELGVPIVMHDYLTGGFTANTSLSHYCRDNGLLLHIHR 4,229.04214 0.51 147.1 9
FLFCAEAIYK 1,203.59976 0.51 73.4 4
IPPAYTK 788.44322 0.19 44.4 34
ASVGFKAGVKEYK 1,382.75571 0.24 31.6 1
NHGMHFR 913.39768 0.12 31.8 14
AMHAVIDR 927.45961 0.14 43.7 85
GRCYHIEPVPGEETQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFK 5,350.51530 0.76 72.9 1
AMHAVIDRQKNHGMHFR 2,110.99010 0.19 51.2 3
TFQGPPHGIQVERDKLNK 2,063.09116 0.24 41.9 2
QKNHGMHFR 1,185.54613 0.09 58.2 107
VALEACVQARNEGR 1,562.74702 0.25 94.2 18
DDYVEKDR 1,038.46178 0.15 59.5 146
ELGVPIVMHDYLTGGFTANTSLSHYCRDNGLLLHIHR 4,213.04723 0.45 97.3 5
ELGVPIVMHDYLTGGFTANTSLSHYCR 2,980.42107 0.54 135.1 4
AMHAVIDR 911.46469 0.18 56.5 12
PLLGCTIKPK 1,068.63650 0.32 46.8 4
CYHIEPVPGEETQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFK 5,137.39275 0.81 131.1 6
WSPELAAACEVWK 1,488.70709 0.54 97.9 2
AGVKEYKLTYYTPEYETK 2,182.08333 0.33 105.9 2
ALAALRLEDLRIPPAYTK 2,010.16254 0.46 41.8 6
GGLDFTKDDENVNSQPFMR 2,184.97453 0.36 84.7 93
ESTLGFVDLLRDDYVEK 1,997.99452 0.51 112.2 64
AMHAVIDR 943.45453 0.18 61.3 274
DLAVEGNEIIREACK 1,706.81444 0.37 118 66
ESTLGFVDLLRDDYVEKDR 2,269.12257 0.49 110 124
DNGLLLHIHR 1,186.65706 0.30 81.9 176
SQAETGEIK 961.47160 0.15 71.3 190
LEGDRESTLGFVDLLR 1,818.94751 0.49 77.1 221
ALAALRLEDLR 1,239.72987 0.41 50.9 103
AVYECLRGGLDFTKDDENVNSQPFMR 3,083.35997 0.43 118.8 28
LTYYTPEYETKDTDILAAFR 2,409.17396 0.48 121.9 53
YGRPLLGCTIKPK 1,444.82239 0.32 58.8 10
NEGRDLAVEGNEIIREACK 2,163.02251 0.33 84 10
VLAKALR 769.51736 0.17 55.4 11
AMHAVIDRQKNHGMHFR 2,094.99518 0.18 28.9 1
LGLSAKNYGR 1,077.59303 0.24 71.2 12
LSGGDHIHAGTVVGKLEGDRESTLGFVDLLR 3,247.69481 0.45 79.2 3
SQAETGEIKGHYLNATAGTCEEMIK 2,760.22176 0.30 106.3 11
DRFLFCAEAIYK 1,522.71256 0.49 114.1 57
WSPELAAACEVWK 1,536.69183 0.52 72.3 5
GGLDFTKDDENVNSQPFMR 2,168.97961 0.40 123.3 9
SQAETGEIKGHYLNATAGTCEEMIKR 2,916.32286 0.28 135.9 58
LSGGDHIHAGTVVGKLEGDR 2,017.03401 0.30 97.9 6
AGVKEYK 793.43335 0.10 56.6 42
GGLDFTKDDENVNSQPFMR 2,200.96945 0.40 136.5 313
LTYYTPEYETK 1,406.66054 0.34 70.9 194
DLAVEGNEIIR 1,227.64586 0.50 103.1 899
DLAVEGNEIIREACKWSPELAAACEVWK 3,129.52623 0.70 32 1
EITFNFPTIDKLDGQE 1,865.90466 0.60 97.9 488
TFQGPPHGIQVER 1,464.74731 0.29 102.8 310
ELGVPIVMHDYLTGGFTANTSLSHYCR 3,060.39564 0.52 126.3 46
FLFCAEAIYKSQAETGEIK 2,195.04555 0.50 87.9 3
PLLGCTIKPK 1,116.62125 0.31 66.4 110
FLFCAEAIYK 1,251.58450 0.55 61.5 119
NHGMHFR 929.39259 0.11 40.6 41
WSPELAAACEVWKEITFNFPTIDK 2,794.36757 0.72 81.5 2
LEGDRESTLGFVDLLRDDYVEK 2,568.27068 0.48 61.9 39
AMHAVIDRQK 1,199.60806 0.11 54.4 22
EACKWSPELAAACEVWK 1,919.89093 0.52 80.3 1
TFQGPPHGIQVERDK 1,707.86922 0.24 77.8 32
QKNHGMHFR 1,169.55121 0.10 40.1 10
AVYECLRGGLDFTK 1,618.76604 0.40 81.7 22
AMHAVIDRQKNHGMHFR 2,047.01042 0.25 30.7 1
GGLDFTK 736.37552 0.27 57.8 56
SQAETGEIKGHYLNATAGTCEEMIKR 2,900.32794 0.26 79.1 3
EYKLTYYTPEYETK 1,826.86140 0.37 84.7 3
VALEACVQAR 1,058.55421 0.40 83.8 9
CYHIEPVPGEETQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFK 5,121.39783 0.79 83.2 1
YGRPLLGCTIK 1,267.65941 0.33 60 14
GIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHP 6,352.17430 0.69 121.7 6
VTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDR 3,853.86456 0.66 125 64
NHGMHFR 897.40276 0.14 37 7
DTDILAAFR 1,020.52399 0.55 82.9 699
LEDLRIPPAYTK 1,414.78198 0.34 68.2 73
EITFNFPTIDK 1,323.67104 0.47 65 84
NHGMHFRVLAK 1,340.67712 0.22 57.7 1
YGRPLLGCTIKPK 1,492.80713 0.29 64.5 98
QKNHGMHFR 1,153.55629 0.19 32.9 1
LSGGDHIHAGTVVGK 1,446.75786 0.22 99.6 263
ESTLGFVDLLR 1,248.67136 0.54 88.5 252
VALEACVQAR 1,106.53896 0.35 94.3 442
AVYECLRGGLDFTKDDENVNSQPFMR 3,067.36505 0.42 55 3
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 15.96 5.68 78.37 7,279 STR-ENV
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 2.60599 0 LAM_high