last update : january 2015

Public data retrieved in 2014



Home

ATCG00490 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein ATCG00490
Master Protein AtCg00490
Description (curated) large subunit of RUBISCO.
Calculated MW (PPDB) 52.95
Calculated PI (PPDB) 5.87
Length 479
Curated Annotation
Description (curated) RBL (RBCL) RuBisCO large subunit, chloroplast encoded (EC 4.1.1.39) /
Function (curated) metabolism carbon
Localization (curated) Ch
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
TFQGPPHGIQVERDKLNK 2,063.09116 0.24 41.9 2
IPPAYTK 788.44322 0.19 44.4 34
NEGRDLAVEGNEIIR 1,683.85393 0.31 86.9 106
VALEACVQARNEGR 1,562.74702 0.25 94.2 18
AGVKEYKLTYYTPEYETK 2,182.08333 0.33 105.9 2
NHGMHFR 897.40276 0.14 37 7
QKNHGMHFR 1,185.54613 0.09 58.2 107
DLAVEGNEIIREACKWSPELAAACEVWK 3,129.52623 0.70 32 1
AMHAVIDR 927.45961 0.14 43.7 85
DLAVEGNEIIREACK 1,706.81444 0.37 118 66
YGRPLLGCTIK 1,267.65941 0.33 60 14
YGRPLLGCTIKPK 1,444.82239 0.32 58.8 10
SQAETGEIKGHYLNATAGTCEEMIKR 2,916.32286 0.28 135.9 58
NHGMHFR 913.39768 0.12 31.8 14
WSPELAAACEVWK 1,536.69183 0.52 72.3 5
AVYECLRGGLDFTKDDENVNSQPFMR 3,083.35997 0.43 118.8 28
QKNHGMHFR 1,153.55629 0.19 32.9 1
VLAKALR 769.51736 0.17 55.4 11
ALAALRLEDLR 1,239.72987 0.41 50.9 103
EACKWSPELAAACEVWK 1,919.89093 0.52 80.3 1
TFQGPPHGIQVERDK 1,707.86922 0.24 77.8 32
DNGLLLHIHR 1,186.65706 0.30 81.9 176
VALEACVQAR 1,106.53896 0.35 94.3 442
WSPELAAACEVWK 1,488.70709 0.54 97.9 2
EYKLTYYTPEYETK 1,826.86140 0.37 84.7 3
ELGVPIVMHDYLTGGFTANTSLSHYCR 2,980.42107 0.54 135.1 4
FLFCAEAIYKSQAETGEIK 2,195.04555 0.50 87.9 3
YGRPLLGCTIKPK 1,492.80713 0.29 64.5 98
PLLGCTIKPK 1,116.62125 0.31 66.4 110
AMHAVIDRQK 1,199.60806 0.11 54.4 22
NHGMHFR 929.39259 0.11 40.6 41
SQAETGEIKGHYLNATAGTCEEMIK 2,760.22176 0.30 106.3 11
GGLDFTKDDENVNSQPFMR 2,168.97961 0.40 123.3 9
ESTLGFVDLLRDDYVEK 1,997.99452 0.51 112.2 64
AMHAVIDR 911.46469 0.18 56.5 12
NHGMHFRVLAK 1,340.67712 0.22 57.7 1
VTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDR 3,853.86456 0.66 125 64
LSGGDHIHAGTVVGKLEGDRESTLGFVDLLR 3,247.69481 0.45 79.2 3
LSGGDHIHAGTVVGKLEGDR 2,017.03401 0.30 97.9 6
GIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHP 6,368.16922 0.66 131.4 2
ELGVPIVMHDYLTGGFTANTSLSHYCRDNGLLLHIHR 4,213.04723 0.45 97.3 5
ELGVPIVMHDYLTGGFTANTSLSHYCR 3,060.39564 0.52 126.3 46
LEGDRESTLGFVDLLRDDYVEK 2,568.27068 0.48 61.9 39
AMHAVIDRQKNHGMHFR 2,110.99010 0.19 51.2 3
AMHAVIDRQKNHGMHFR 2,047.01042 0.25 30.7 1
NEGRDLAVEGNEIIREACK 2,163.02251 0.33 84 10
AGVKEYK 793.43335 0.10 56.6 42
AMHAVIDR 943.45453 0.18 61.3 274
SQAETGEIK 961.47160 0.15 71.3 190
ASVGFKAGVKEYK 1,382.75571 0.24 31.6 1
LTYYTPEYETKDTDILAAFR 2,409.17396 0.48 121.9 53
ELGVPIVMHDYLTGGFTANTSLSHYCR 3,044.40073 0.46 115.6 5
ELGVPIVMHDYLTGGFTANTSLSHYCRDNGLLLHIHR 4,229.04214 0.51 147.1 9
AMHAVIDRQKNHGMHFR 2,094.99518 0.18 28.9 1
AVYECLRGGLDFTKDDENVNSQPFMR 3,067.36505 0.42 55 3
LSGGDHIHAGTVVGK 1,446.75786 0.22 99.6 263
PLLGCTIKPK 1,068.63650 0.32 46.8 4
DLAVEGNEIIR 1,227.64586 0.50 103.1 899
CYHIEPVPGEETQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFK 5,137.39275 0.81 131.1 6
ESTLGFVDLLRDDYVEKDR 2,269.12257 0.49 110 124
GGLDFTKDDENVNSQPFMR 2,200.96945 0.40 136.5 313
FLFCAEAIYK 1,203.59976 0.51 73.4 4
LEDLRIPPAYTK 1,414.78198 0.34 68.2 73
GGLDFTKDDENVNSQPFMR 2,184.97453 0.36 84.7 93
DTDILAAFR 1,020.52399 0.55 82.9 699
EITFNFPTIDKLDGQE 1,865.90466 0.60 97.9 488
LGLSAKNYGR 1,077.59303 0.24 71.2 12
DDYVEKDR 1,038.46178 0.15 59.5 146
GGLDFTK 736.37552 0.27 57.8 56
FLFCAEAIYK 1,251.58450 0.55 61.5 119
ALRLSGGDHIHAGTVVGK 1,786.98013 0.27 85.7 7
EITFNFPTIDK 1,323.67104 0.47 65 84
VALEACVQAR 1,058.55421 0.40 83.8 9
ALAALRLEDLRIPPAYTK 2,010.16254 0.46 41.8 6
CYHIEPVPGEETQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFK 5,121.39783 0.79 83.2 1
QKNHGMHFR 1,169.55121 0.10 40.1 10
SQAETGEIKGHYLNATAGTCEEMIKR 2,900.32794 0.26 79.1 3
AVYECLRGGLDFTK 1,618.76604 0.40 81.7 22
ESTLGFVDLLR 1,248.67136 0.54 88.5 252
LEGDRESTLGFVDLLR 1,818.94751 0.49 77.1 221
TFQGPPHGIQVER 1,464.74731 0.29 102.8 310
DRFLFCAEAIYK 1,522.71256 0.49 114.1 57
GRCYHIEPVPGEETQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFK 5,350.51530 0.76 72.9 1
LTYYTPEYETK 1,406.66054 0.34 70.9 194
GIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHP 6,352.17430 0.69 121.7 6
WSPELAAACEVWKEITFNFPTIDK 2,794.36757 0.72 81.5 2
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 15.96 5.68 78.37 7,279 STR-ENV
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 2.60599 0 LAM_high