last update : january 2015

Public data retrieved in 2014



Home

ATCG00490 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein ATCG00490
Master Protein AtCg00490
Description (curated) large subunit of RUBISCO.
Calculated MW (PPDB) 52.95
Calculated PI (PPDB) 5.87
Length 479
Curated Annotation
Description (curated) RBL (RBCL) RuBisCO large subunit, chloroplast encoded (EC 4.1.1.39) /
Function (curated) metabolism carbon
Localization (curated) Ch
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
ALAALRLEDLRIPPAYTK 2,010.16254 0.46 41.8 6
ELGVPIVMHDYLTGGFTANTSLSHYCR 2,980.42107 0.54 135.1 4
NHGMHFR 929.39259 0.11 40.6 41
YGRPLLGCTIKPK 1,492.80713 0.29 64.5 98
IPPAYTK 788.44322 0.19 44.4 34
LSGGDHIHAGTVVGKLEGDR 2,017.03401 0.30 97.9 6
AMHAVIDR 911.46469 0.18 56.5 12
CYHIEPVPGEETQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFK 5,121.39783 0.79 83.2 1
AVYECLRGGLDFTKDDENVNSQPFMR 3,083.35997 0.43 118.8 28
LTYYTPEYETK 1,406.66054 0.34 70.9 194
GIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHP 6,352.17430 0.69 121.7 6
NHGMHFR 913.39768 0.12 31.8 14
ALAALRLEDLR 1,239.72987 0.41 50.9 103
QKNHGMHFR 1,169.55121 0.10 40.1 10
DLAVEGNEIIR 1,227.64586 0.50 103.1 899
EACKWSPELAAACEVWK 1,919.89093 0.52 80.3 1
AMHAVIDR 943.45453 0.18 61.3 274
VTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDR 3,853.86456 0.66 125 64
AMHAVIDR 927.45961 0.14 43.7 85
ESTLGFVDLLRDDYVEKDR 2,269.12257 0.49 110 124
QKNHGMHFR 1,185.54613 0.09 58.2 107
VALEACVQAR 1,106.53896 0.35 94.3 442
AMHAVIDRQKNHGMHFR 2,110.99010 0.19 51.2 3
LSGGDHIHAGTVVGK 1,446.75786 0.22 99.6 263
FLFCAEAIYKSQAETGEIK 2,195.04555 0.50 87.9 3
AVYECLRGGLDFTKDDENVNSQPFMR 3,067.36505 0.42 55 3
EITFNFPTIDKLDGQE 1,865.90466 0.60 97.9 488
VLAKALR 769.51736 0.17 55.4 11
LSGGDHIHAGTVVGKLEGDRESTLGFVDLLR 3,247.69481 0.45 79.2 3
AGVKEYKLTYYTPEYETK 2,182.08333 0.33 105.9 2
ASVGFKAGVKEYK 1,382.75571 0.24 31.6 1
TFQGPPHGIQVERDK 1,707.86922 0.24 77.8 32
SQAETGEIKGHYLNATAGTCEEMIKR 2,916.32286 0.28 135.9 58
SQAETGEIK 961.47160 0.15 71.3 190
DLAVEGNEIIREACKWSPELAAACEVWK 3,129.52623 0.70 32 1
NEGRDLAVEGNEIIR 1,683.85393 0.31 86.9 106
AMHAVIDRQK 1,199.60806 0.11 54.4 22
NHGMHFRVLAK 1,340.67712 0.22 57.7 1
ALRLSGGDHIHAGTVVGK 1,786.98013 0.27 85.7 7
GRCYHIEPVPGEETQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFK 5,350.51530 0.76 72.9 1
YGRPLLGCTIK 1,267.65941 0.33 60 14
DNGLLLHIHR 1,186.65706 0.30 81.9 176
VALEACVQARNEGR 1,562.74702 0.25 94.2 18
WSPELAAACEVWKEITFNFPTIDK 2,794.36757 0.72 81.5 2
GGLDFTK 736.37552 0.27 57.8 56
LEGDRESTLGFVDLLR 1,818.94751 0.49 77.1 221
GGLDFTKDDENVNSQPFMR 2,184.97453 0.36 84.7 93
QKNHGMHFR 1,153.55629 0.19 32.9 1
LEGDRESTLGFVDLLRDDYVEK 2,568.27068 0.48 61.9 39
DRFLFCAEAIYK 1,522.71256 0.49 114.1 57
NHGMHFR 897.40276 0.14 37 7
TFQGPPHGIQVERDKLNK 2,063.09116 0.24 41.9 2
DTDILAAFR 1,020.52399 0.55 82.9 699
AVYECLRGGLDFTK 1,618.76604 0.40 81.7 22
EITFNFPTIDK 1,323.67104 0.47 65 84
VALEACVQAR 1,058.55421 0.40 83.8 9
SQAETGEIKGHYLNATAGTCEEMIK 2,760.22176 0.30 106.3 11
FLFCAEAIYK 1,203.59976 0.51 73.4 4
FLFCAEAIYK 1,251.58450 0.55 61.5 119
WSPELAAACEVWK 1,488.70709 0.54 97.9 2
ELGVPIVMHDYLTGGFTANTSLSHYCRDNGLLLHIHR 4,213.04723 0.45 97.3 5
AMHAVIDRQKNHGMHFR 2,094.99518 0.18 28.9 1
AMHAVIDRQKNHGMHFR 2,047.01042 0.25 30.7 1
PLLGCTIKPK 1,068.63650 0.32 46.8 4
DDYVEKDR 1,038.46178 0.15 59.5 146
GIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHP 6,368.16922 0.66 131.4 2
YGRPLLGCTIKPK 1,444.82239 0.32 58.8 10
DLAVEGNEIIREACK 1,706.81444 0.37 118 66
SQAETGEIKGHYLNATAGTCEEMIKR 2,900.32794 0.26 79.1 3
LEDLRIPPAYTK 1,414.78198 0.34 68.2 73
WSPELAAACEVWK 1,536.69183 0.52 72.3 5
ESTLGFVDLLR 1,248.67136 0.54 88.5 252
AGVKEYK 793.43335 0.10 56.6 42
GGLDFTKDDENVNSQPFMR 2,200.96945 0.40 136.5 313
ESTLGFVDLLRDDYVEK 1,997.99452 0.51 112.2 64
TFQGPPHGIQVER 1,464.74731 0.29 102.8 310
CYHIEPVPGEETQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFK 5,137.39275 0.81 131.1 6
ELGVPIVMHDYLTGGFTANTSLSHYCR 3,060.39564 0.52 126.3 46
LTYYTPEYETKDTDILAAFR 2,409.17396 0.48 121.9 53
GGLDFTKDDENVNSQPFMR 2,168.97961 0.40 123.3 9
NEGRDLAVEGNEIIREACK 2,163.02251 0.33 84 10
PLLGCTIKPK 1,116.62125 0.31 66.4 110
EYKLTYYTPEYETK 1,826.86140 0.37 84.7 3
ELGVPIVMHDYLTGGFTANTSLSHYCR 3,044.40073 0.46 115.6 5
LGLSAKNYGR 1,077.59303 0.24 71.2 12
ELGVPIVMHDYLTGGFTANTSLSHYCRDNGLLLHIHR 4,229.04214 0.51 147.1 9
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 15.96 5.68 78.37 7,279 STR-ENV
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 2.60599 0 LAM_high