last update : january 2015

Public data retrieved in 2014



Home

ATCG00270 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein ATCG00270
Master Protein AtCg00270
Description (curated) PSII D2 protein
Calculated MW (PPDB) 39.54
Calculated PI (PPDB) 5.45
Length 353
Curated Annotation
Description (curated) PSBD (D2) subunit of the photosystem II reaction center, chloroplast encoded /
Function (curated) PS PSII
Localization (curated) Ch/Th
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
AYDFVSQEIR 1,226.59311 0.38 86.3 52
NILLNEGIRAWMAAQDQPHENLIFPEEVLPR 3,628.84593 0.59 78.2 3
AAEDPEFETFYTK 1,546.68271 0.40 102.2 121
AFNPTQAEETYSMVTANR 2,044.91597 0.40 134.7 21
NILLNEGIR 1,040.59779 0.36 68.1 232
FWSQIFGVAFSNK 1,529.76663 0.55 100.9 6
AWMAAQDQPHENLIFPEEVLPR 2,606.25870 0.47 96.7 6
AFNPTQAEETYSMVTANR 2,060.91089 0.41 131.5 51
DLFDIMDDWLR 1,469.64967 0.60 66.9 3
DLFDIMDDWLR 1,453.65476 0.58 76.6 4
TIALGKFTK 1,019.60149 0.39 48.3 18
AAEDPEFETFYTKNILLNEGIR 2,569.26994 0.51 107.6 2
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST -1.89659 0 BBY_high
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 2.64 97.28 0.08 495 THY