last update : january 2015

Public data retrieved in 2014



Home

AT5G63570 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT5G63570
Master Protein AT5G63570.1
Description (curated) GSA1 (GLUTAMATE-1-SEMIALDEHYDE-2,1-AMINOMUTASE); glutamate-1-semialdehyde 2,1-aminomutase
Calculated MW (PPDB) 50.37
Calculated PI (PPDB) 6.42
Length 474
Curated Annotation
Description (curated) GSA1 (GSA-AT1) Glutamate-1-semialdehyde 2,1-aminomutase 1, chloroplast precursor /
Function (curated) metabolism vitamin and pigment
Localization (curated) Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
AFTNKEK 836.43918 0.08 36.4 2
SVGGQPVLIDSVK 1,297.72411 0.33 75.9 41
QLTKDNGVLLIFDEVMTGFR 2,327.18306 0.59 56.7 1
IIGGGLPVGAYGGR 1,285.71417 0.36 87.1 53
GEISAVILEPVVGNSGFIPPTPEFINGLR 3,021.61739 0.62 97.4 3
NLMPGGVNSPVR 1,239.63933 0.34 29.8 1
DNGVLLIFDEVMTGFR 1,840.90286 0.67 111.7 5
SVGGQPVLIDSVKGSK 1,569.87254 0.28 56.1 1
FVNSGTEACMGVLR 1,562.67042 0.34 110.4 22
GMLEEGVYFAPSQFEAGFTSLAHTPEDIQLTIAAAER 4,011.91992 0.67 38.8 2
LAYGGAQEYFGITPDLTTLGK 2,214.12077 0.53 114.3 29
FVNSGTEACMGVLR 1,546.67551 0.33 109.2 7
GTSFGAPCLLENVLAEMVISAVPSIEMVR 3,144.50278 0.78 77.3 4
ELTNGILEAGKK 1,271.70845 0.25 56.6 5
LFAAHKGEISAVILEPVVGNSGFIPPTPEFINGLR 3,688.99794 0.54 66.3 1
DNGVLLIFDEVMTGFR 1,824.90794 0.76 111.6 2
FVNSGTEACMGVLR 1,482.69585 0.42 60.5 1
NLMPGGVNSPVR 1,255.63425 0.26 62.1 20
GTSFGAPCLLENVLAEMVISAVPSIEMVR 3,112.51294 0.77 60.7 1
NLMPGGVNSPVR 1,271.62917 0.27 62.9 45
ELTNGILEAGK 1,143.61350 0.32 62.4 15
SEEAFNAAK 965.44537 0.18 59.5 22
AGSGVATLGLPDSPGVPK 1,621.86746 0.38 88.6 74
AATSDTLTAPYNDLEAVEK 2,007.96364 0.42 100.1 37
QAGTYEYLDK 1,186.55058 0.28 41.2 4
DIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLK 3,449.63384 0.44 83 6
DIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKR 3,669.71462 0.43 52.7 1
SDTEKFGR 938.44572 0.14 58.1 2
DNGVLLIFDEVMTGFR 1,856.89778 0.67 125.3 29
DIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLK 3,513.61351 0.47 91.4 2
KSDTEKFGR 1,066.54068 0.11 83.9 5
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 6.22 1 92.78 437 STR
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 0 1 -