last update : january 2015

Public data retrieved in 2014



Home

AT5G50920 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT5G50920
Master Protein AT5G50920.1
Description (curated) CLPC (HEAT SHOCK PROTEIN 93-V); ATP binding / ATPase
Calculated MW (PPDB) 103.45
Calculated PI (PPDB) 6.36
Length 929
Curated Annotation
Description (curated) ClpC1 (HSP93-V, Hsp100) ATP-dependent Clp protease ATP-binding subunit, chloroplast precursor /
Function (curated) chaperone and protease
Localization (curated) Ch/E & Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
TVDFKNTLLIMTSNVGSSVIEK 2,395.26678 0.57 40.9 1
IGFDLDYDEKDSSYNR 1,935.84860 0.38 106 5
VVDEGYNPSYGAR 1,425.65239 0.26 96 61
AHPDVFNMMLQILEDGR 2,032.93460 0.46 73.4 3
KVITLDMGLLVAGTK 1,589.90617 0.39 100.4 13
LAEEGKLDPVVGRQPQIER 2,133.15413 0.28 49.2 5
VIMLAQEEAR 1,158.60664 0.30 50.5 3
KEIELQVTER 1,243.67717 0.25 64.9 4
LLEDSMAEK 1,066.48521 0.20 61.6 54
IGFDLDYDEK 1,213.55025 0.42 91.2 9
LDMSEFMER 1,172.48416 0.38 24.7 1
MEETLHKR 1,058.51785 0.10 42.4 3
RVLELSLEEAR 1,313.73026 0.33 60 12
VIMLAQEEARR 1,346.69759 0.25 49.3 16
MEETLHKR 1,074.51277 0.09 39.9 11
KVITLDMGLLVAGTK 1,573.91126 0.39 86.1 3
DREIELR 929.49301 0.23 28.2 1
NPNRPIASFIFSGPTGVGK 1,958.03731 0.43 112.1 74
QSDEIILFIDEVHTLIGAGAAEGAIDAANILKPALAR 3,815.04677 0.74 81.1 5
MPTLEEYGTNLTK 1,511.71773 0.36 88.4 22
EIADILLKEVFER 1,573.87149 0.55 70.5 6
QYFRPEFLNR 1,368.69382 0.36 32 8
IASGDVPETIEGK 1,314.66666 0.29 86.1 85
NTLLIMTSNVGSSVIEK 1,804.96039 0.45 66.6 1
RFQPVKVPEPTVDETIQILK 2,336.31032 0.42 41.5 1
NEAVRGQDFEK 1,291.61562 0.18 48 3
LLEDSMAEK 1,050.49030 0.19 59.5 22
LDMSEFMER 1,188.47908 0.27 50.5 20
AEVSAIQAK 915.50250 0.18 62.4 36
VSTDESDRLLK 1,261.65137 0.24 60.4 21
LRHAQVPEEAR 1,304.69488 0.18 30 1
YTDESLVAAAQLSYQYISDR 2,292.09096 0.58 119.5 5
LLEDSMAEKMLAR 1,569.73781 0.29 73.9 4
QLGHNYIGSEHLLLGLLR 2,032.12172 0.46 78.2 13
AIDLIDEAGSR 1,158.58803 0.35 106.4 118
EGEGVAAR 787.38237 0.11 51.5 25
HAQVPEEARELEK 1,534.77391 0.23 35.2 4
MVGENNEVTANVGGGSSSNK 1,981.86461 0.23 177.8 89
LLKMEETLHKR 1,428.77585 0.16 51.5 5
SLVTEELKQYFRPEFLNR 2,268.19019 0.49 34 1
GSGFVAVEIPFTPR 1,475.77719 0.48 85.4 71
GELQCIGATTLDEYRK 1,843.86214 0.42 82.2 28
AHPDVFNMMLQILEDGR 2,048.92952 0.50 102.7 9
IIGQDEAVKAISR 1,398.78302 0.30 76.9 3
MPTLEEYGTNLTK 1,527.71265 0.37 100.4 59
EIADILLK 913.54840 0.41 65.8 43
SMGINLK 793.40036 0.23 51.6 10
NTLLIMTSNVGSSVIEK 1,836.95023 0.41 130.9 51
VIMLAQEEAR 1,174.60156 0.27 72.5 32
AESETGEEGPMVTESDIQHIVSSWTGIPVEK 3,357.55576 0.61 86.9 3
GELQCIGATTLDEYR 1,715.76718 0.49 40 2
FQPVKVPEPTVDETIQILK 2,180.20921 0.45 73 11
VEVEKIIGR 1,041.61818 0.27 61.7 5
RIIGQDEAVK 1,127.62982 0.19 36.4 6
ELEKELR 915.50250 0.18 31.7 1
LGHNFVGTEQILLGLIGEGTGIAAK 2,507.37465 0.60 105.6 29
EKNEAVR 844.44023 0.05 37 2
TKNNPCLIGEPGVGK 1,573.77693 0.28 79.3 13
LDMSEFMER 1,204.47400 0.29 69.5 26
MEETLHK 918.41167 0.12 38.6 2
SMGINLKDAR 1,135.56552 0.22 50.7 7
NTLLIMTSNVGSSVIEK 1,820.95531 0.40 142.3 20
EKNEAVRGQDFEK 1,548.75316 0.17 67.8 7
AHPDVFNMMLQILEDGR 2,016.93968 0.45 85.7 11
HAQVPEEAR 1,035.50972 0.14 53.9 16
RIGFDLDYDEKDSSYNR 2,091.94971 0.35 54.2 2
KLMEEIR 949.49023 0.18 46.8 12
VVQILGR 783.49663 0.28 58.5 35
ALAAYYFGSEEAMIR 1,706.79733 0.44 93.1 11
LDPVVGR 754.43370 0.23 51.7 6
VVQILGRR 939.59773 0.23 24.9 1
YRGEFEER 1,084.49371 0.19 42 24
MVGENNEVTANVGGGSSSNK 1,965.86969 0.23 162.6 28
VITLDMGLLVAGTK 1,445.81630 0.44 112.2 17
FLPDKAIDLIDEAGSR 1,758.91516 0.45 98.4 30
TAIAEGLAQR 1,028.56142 0.26 81.3 134
SMGINLK 777.40544 0.21 33.5 1
LDEMIVFR 1,037.52153 0.36 67.8 15
LIGSPPGYVGYTEGGQLTEAVR 2,263.14836 0.43 136.4 34
VPEPTVDETIQILK 1,580.86610 0.45 121.9 58
IASGDVPETIEGKK 1,442.76161 0.25 72 64
LDMSEFMER 1,220.46892 0.31 57.5 49
LAEEGKLDPVVGR 1,381.75645 0.27 90.5 86
RLGHNFVGTEQILLGLIGEGTGIAAK 2,663.47575 0.54 44.2 3
LDMSEFMER 1,156.48924 0.43 43 1
EIELQVTER 1,115.58221 0.31 71.9 62
VSTDESDR 907.38829 0.09 51.8 12
VITLDMGLLVAGTK 1,461.81122 0.45 102.9 47
IIGQDEAVK 971.52872 0.22 65.8 31
VIMLAQEEAR 1,190.59648 0.28 75.2 97
VLELSLEEAR 1,157.62915 0.38 100.3 113
VLENLGADPSNIR 1,396.73099 0.33 90 153
HIEKDPALER 1,206.63565 0.17 62.1 38
LDEMIVFR 1,021.52661 0.43 62.2 2
RPYTVVLFDEIEK 1,607.85585 0.44 81.5 17
KKEIELQVTER 1,371.77212 0.21 69.6 5
MVGENNEVTANVGGGSSSNK 1,949.87477 0.27 59 1
ALAAYYFGSEEAMIR 1,722.79225 0.44 76.6 10
QLTKLEVK 957.58585 0.22 29 1
SLVTEELK 917.50693 0.31 40.7 15
LDEMIVFR 1,053.51645 0.38 56.1 43
NNPCLIGEPGVGK 1,344.63429 0.33 78.4 10
MEETLHK 902.41675 0.13 31.9 3
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 61.47 5.23 33.3 2,411 ENV-STR
Reference of the experiment Reference date Sample CAM Binding Protein
cam_bp 2013-01-01 00:00:00 CET Arabidopsis_stroma;Arabidopsis_membranes;
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 0.23801 0.38957 -