last update : january 2015

Public data retrieved in 2014



Home

AT5G49910 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT5G49910
Master Protein AT5G49910.1
Description (curated) cpHSC70-2 (HEAT SHOCK PROTEIN 70-7); ATP binding / unfolded protein binding
Calculated MW (PPDB) 76.99
Calculated PI (PPDB) 5.17
Length 718
Curated Annotation
Description (curated) cpHSP70-2 (Dnak homologue) heat shock protein 70-7, chloroplast precursor /
Function (curated) chaperone and protease
Localization (curated) Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
DKQALQR 857.47189 0.08 38.5 2
QDITITGASTLPK 1,343.72963 0.35 34.8 1
RMNEVAEESK 1,223.54517 0.11 47.7 12
EFVRDNK 906.45589 0.11 37.4 1
QFAAEEISAQVLRK 1,588.85724 0.37 77.9 8
KDEGIDLLK 1,029.57059 0.31 40.1 6
NQADSVVYQTEK 1,380.65208 0.24 101.4 68
IASGSTQEIK 1,032.54510 0.17 60.3 16
VIKDENGNVKLDCPAIGK 1,959.99345 0.27 62.4 5
MNEVAEESKQVSYR 1,700.76750 0.23 52.9 3
IELSSLTQTNMSLPFITATADGPK 2,566.28360 0.52 131.3 7
TPVENSLR 914.48212 0.20 61 24
DIDEVILVGGSTR 1,372.71976 0.42 74 22
NTTLPTSK 860.46034 0.15 38.7 1
VVDWLASTFK 1,164.61787 0.48 72.7 8
VVGIDLGTTNSAVAAMEGGKPTIVTNAEGQR 3,087.55052 0.40 125 5
TTPSVVAYTK 1,065.57060 0.25 32.1 2
QAVVNPENTFFSVK 1,578.80414 0.43 90.9 88
VVGIDLGTTNSAVAAMEGGKPTIVTNAEGQR 3,055.56068 0.47 94 3
RQAVVNPENTFFSVK 1,734.90524 0.37 65.8 6
DAIDTKNQADSVVYQTEK 2,023.96979 0.28 78.7 2
LSFKDIDEVILVGGSTR 1,847.99921 0.51 122.6 17
KLVDDASR 902.48212 0.14 52.5 29
DEGIDLLKDKQALQR 1,740.93697 0.33 35 1
IPGPVKEK 866.52251 0.13 26.8 1
LVGQIAK 727.45918 0.20 39.9 8
IPAVQDLVRK 1,137.68695 0.30 27.3 1
FAKEDKEK 993.51306 0.04 39.4 1
ELGEKIPGPVK 1,165.67061 0.25 41.9 5
LVDDASR 774.38716 0.13 57.4 14
LTEAAEK 760.39665 0.10 42.5 15
LVGQIAKR 883.56029 0.16 60.1 5
KQDITITGASTLPK 1,471.82458 0.30 92.3 17
KQDITITGASTLPKDEVDTMVQEAER 2,906.41785 0.37 119.3 5
GVPQIEVK 868.50177 0.29 22.6 1
IAGLEVLR 869.53340 0.36 67.2 61
QAVVNPENTFFSVKR 1,734.90524 0.36 60.2 9
MNEVAEESK 1,067.44406 0.12 72.9 29
RQAVVNPENTFFSVKR 1,891.00635 0.32 53.6 2
DRLVGQIAK 998.58723 0.21 31.5 2
FLNDKVTK 963.53890 0.20 58.2 7
VVGIDLGTTNSAVAAMEGGKPTIVTNAEGQR 3,071.55560 0.39 146.7 2
GGDNGGDVIDADFTDSN 1,667.65465 0.39 87.6 5
GKFEELCSDLLDRVR 1,826.88319 0.40 83 7
DEGIDLLK 901.47563 0.38 40.8 4
DEVDTMVQEAER 1,452.60382 0.29 72.9 6
FEELCSDLLDRVR 1,641.76678 0.44 37.5 1
GKFEELCSDLLDR 1,571.71368 0.41 99.2 17
IINEPTAASLAYGFER 1,750.88893 0.44 122.4 47
KDEGIDLLKDK 1,272.69249 0.27 68.4 17
QFAAEEISAQVLR 1,460.76228 0.44 112.3 61
VIKDENGNVK 1,114.59818 0.12 57.1 17
DEGIDLLKDK 1,144.59753 0.32 70.4 26
DEVDTMVQEAER 1,436.60890 0.26 84.7 5
HIETTLTR 969.52434 0.20 34.3 7
MNEVAEESK 1,051.44914 0.13 44.7 11
TPVENSLRDAK 1,228.64113 0.19 48.2 1
LTEAAEKAK 959.52872 0.08 37.8 1
VRTPVENSLR 1,169.65163 0.21 53.3 8
AVITVPAYFNDSQR 1,579.79941 0.42 61.2 35
AKIELSSLTQTNMSLPFITATADGPK 2,765.41566 0.48 71.3 4
IPAVQDLVR 1,009.59200 0.36 61.7 68
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 7.38 0.47 92.15 807 STR
Reference of the experiment Reference date Sample CAM Binding Protein
cam_bp 2013-01-01 00:00:00 CET Arabidopsis_stroma;
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 0 1 -