last update : january 2015

Public data retrieved in 2014



Home

AT5G49910 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT5G49910
Master Protein AT5G49910.1
Description (curated) cpHSC70-2 (HEAT SHOCK PROTEIN 70-7); ATP binding / unfolded protein binding
Calculated MW (PPDB) 76.99
Calculated PI (PPDB) 5.17
Length 718
Curated Annotation
Description (curated) cpHSP70-2 (Dnak homologue) heat shock protein 70-7, chloroplast precursor /
Function (curated) chaperone and protease
Localization (curated) Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
FLNDKVTK 963.53890 0.20 58.2 7
TPVENSLRDAK 1,228.64113 0.19 48.2 1
IPAVQDLVR 1,009.59200 0.36 61.7 68
IPGPVKEK 866.52251 0.13 26.8 1
VIKDENGNVKLDCPAIGK 1,959.99345 0.27 62.4 5
IAGLEVLR 869.53340 0.36 67.2 61
KQDITITGASTLPKDEVDTMVQEAER 2,906.41785 0.37 119.3 5
QDITITGASTLPK 1,343.72963 0.35 34.8 1
FAKEDKEK 993.51306 0.04 39.4 1
DKQALQR 857.47189 0.08 38.5 2
RQAVVNPENTFFSVK 1,734.90524 0.37 65.8 6
IELSSLTQTNMSLPFITATADGPK 2,566.28360 0.52 131.3 7
EFVRDNK 906.45589 0.11 37.4 1
DEGIDLLKDK 1,144.59753 0.32 70.4 26
VVDWLASTFK 1,164.61787 0.48 72.7 8
MNEVAEESKQVSYR 1,700.76750 0.23 52.9 3
LTEAAEKAK 959.52872 0.08 37.8 1
GKFEELCSDLLDR 1,571.71368 0.41 99.2 17
AKIELSSLTQTNMSLPFITATADGPK 2,765.41566 0.48 71.3 4
TPVENSLR 914.48212 0.20 61 24
NQADSVVYQTEK 1,380.65208 0.24 101.4 68
DEVDTMVQEAER 1,436.60890 0.26 84.7 5
LVDDASR 774.38716 0.13 57.4 14
LVGQIAKR 883.56029 0.16 60.1 5
VVGIDLGTTNSAVAAMEGGKPTIVTNAEGQR 3,071.55560 0.39 146.7 2
KLVDDASR 902.48212 0.14 52.5 29
NTTLPTSK 860.46034 0.15 38.7 1
KQDITITGASTLPK 1,471.82458 0.30 92.3 17
LSFKDIDEVILVGGSTR 1,847.99921 0.51 122.6 17
DIDEVILVGGSTR 1,372.71976 0.42 74 22
KDEGIDLLK 1,029.57059 0.31 40.1 6
MNEVAEESK 1,051.44914 0.13 44.7 11
GVPQIEVK 868.50177 0.29 22.6 1
VVGIDLGTTNSAVAAMEGGKPTIVTNAEGQR 3,087.55052 0.40 125 5
LVGQIAK 727.45918 0.20 39.9 8
LTEAAEK 760.39665 0.10 42.5 15
AVITVPAYFNDSQR 1,579.79941 0.42 61.2 35
DAIDTKNQADSVVYQTEK 2,023.96979 0.28 78.7 2
VVGIDLGTTNSAVAAMEGGKPTIVTNAEGQR 3,055.56068 0.47 94 3
QAVVNPENTFFSVK 1,578.80414 0.43 90.9 88
QFAAEEISAQVLRK 1,588.85724 0.37 77.9 8
MNEVAEESK 1,067.44406 0.12 72.9 29
TTPSVVAYTK 1,065.57060 0.25 32.1 2
IPAVQDLVRK 1,137.68695 0.30 27.3 1
RQAVVNPENTFFSVKR 1,891.00635 0.32 53.6 2
QFAAEEISAQVLR 1,460.76228 0.44 112.3 61
FEELCSDLLDRVR 1,641.76678 0.44 37.5 1
GGDNGGDVIDADFTDSN 1,667.65465 0.39 87.6 5
IASGSTQEIK 1,032.54510 0.17 60.3 16
DEGIDLLKDKQALQR 1,740.93697 0.33 35 1
QAVVNPENTFFSVKR 1,734.90524 0.36 60.2 9
VIKDENGNVK 1,114.59818 0.12 57.1 17
ELGEKIPGPVK 1,165.67061 0.25 41.9 5
GKFEELCSDLLDRVR 1,826.88319 0.40 83 7
KDEGIDLLKDK 1,272.69249 0.27 68.4 17
DRLVGQIAK 998.58723 0.21 31.5 2
IINEPTAASLAYGFER 1,750.88893 0.44 122.4 47
DEGIDLLK 901.47563 0.38 40.8 4
VRTPVENSLR 1,169.65163 0.21 53.3 8
DEVDTMVQEAER 1,452.60382 0.29 72.9 6
RMNEVAEESK 1,223.54517 0.11 47.7 12
HIETTLTR 969.52434 0.20 34.3 7
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 7.38 0.47 92.15 807 STR
Reference of the experiment Reference date Sample CAM Binding Protein
cam_bp 2013-01-01 00:00:00 CET Arabidopsis_stroma;
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 0 1 -