last update : january 2015

Public data retrieved in 2014



Home

AT5G36700 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT5G36700
Master Protein AT5G36700.1
Description (curated) ATPGLP1/PGLP1 (2-PHOSPHOGLYCOLATE PHOSPHATASE 1); phosphoglycolate phosphatase
Calculated MW (PPDB) 39.76
Calculated PI (PPDB) 6.89
Length 362
Curated Annotation
Description (curated) PGP1 Phosphoglycolate phosphatase 1, chloroplast precursor /
Function (curated) metabolism carbon
Localization (curated) Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
LVFVTNNSTK 1,121.60803 0.29 62.2 51
KFETLGLNVNEEEIFASSFAAAAYLQSINFPK 3,547.78735 0.68 70.8 2
SQICMVGDR 1,071.43246 0.22 53.7 4
PSTFMMDYLADK 1,433.62067 0.41 50.9 1
PSTFMMDYLADK 1,417.62575 0.46 82.1 4
LIEGVPETLDMLR 1,500.78574 0.45 72.7 10
IQYGTLCIR 1,113.54881 0.42 48.9 12
TLLVLSGVTSISMLESPENK 2,149.11874 0.53 92.2 10
IQPDFYTSK 1,097.53931 0.30 42.8 4
RLVFVTNNSTK 1,277.70914 0.25 68.5 18
ELELAGFQYLGGPDDGKR 1,963.96387 0.45 122.8 15
TLLVLSGVTSISMLESPENK 2,133.12382 0.53 130.3 7
VYVIGEEGILK 1,218.68591 0.41 90.6 25
PSTFMMDYLADK 1,481.60542 0.37 86.4 8
DAVTHLTDAQEWAGGGSMVGALVGSTQR 2,813.34016 0.52 70.8 4
LDTDILFGQNGGCK 1,527.68747 0.48 49.8 1
SQICMVGDR 1,087.42738 0.24 53.8 5
PSTFMMDYLADK 1,449.61558 0.34 75.1 4
KVYVIGEEGILK 1,346.78087 0.35 72.4 2
ISDFLSPK 905.48581 0.33 53.5 31
EPLVVGKPSTFMMDYLADK 2,204.03806 0.40 76.6 3
LIEGVPETLDMLR 1,516.78066 0.45 89.5 20
ELELAGFQYLGGPDDGK 1,807.86276 0.51 56.8 3
DAVTHLTDAQEWAGGGSMVGALVGSTQR 2,829.33508 0.45 126.7 3
LIEGVPETLDMLR 1,484.79082 0.51 38.4 2
EPLVVGKPSTFMMDYLADKFGIQK 2,713.38583 0.57 58.5 2
ENPGCLFIATNR 1,381.62956 0.44 83.3 21
GDKLIEGVPETLDMLR 1,816.92401 0.43 99.5 6
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 2.84 0 97.16 269 STR