last update : january 2015

Public data retrieved in 2014



Home

AT5G36700 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT5G36700
Master Protein AT5G36700.1
Description (curated) ATPGLP1/PGLP1 (2-PHOSPHOGLYCOLATE PHOSPHATASE 1); phosphoglycolate phosphatase
Calculated MW (PPDB) 39.76
Calculated PI (PPDB) 6.89
Length 362
Curated Annotation
Description (curated) PGP1 Phosphoglycolate phosphatase 1, chloroplast precursor /
Function (curated) metabolism carbon
Localization (curated) Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
KFETLGLNVNEEEIFASSFAAAAYLQSINFPK 3,547.78735 0.68 70.8 2
SQICMVGDR 1,071.43246 0.22 53.7 4
PSTFMMDYLADK 1,417.62575 0.46 82.1 4
DAVTHLTDAQEWAGGGSMVGALVGSTQR 2,813.34016 0.52 70.8 4
EPLVVGKPSTFMMDYLADKFGIQK 2,713.38583 0.57 58.5 2
TLLVLSGVTSISMLESPENK 2,133.12382 0.53 130.3 7
KVYVIGEEGILK 1,346.78087 0.35 72.4 2
LDTDILFGQNGGCK 1,527.68747 0.48 49.8 1
EPLVVGKPSTFMMDYLADK 2,204.03806 0.40 76.6 3
ELELAGFQYLGGPDDGK 1,807.86276 0.51 56.8 3
ISDFLSPK 905.48581 0.33 53.5 31
SQICMVGDR 1,087.42738 0.24 53.8 5
GDKLIEGVPETLDMLR 1,816.92401 0.43 99.5 6
LIEGVPETLDMLR 1,516.78066 0.45 89.5 20
PSTFMMDYLADK 1,481.60542 0.37 86.4 8
IQPDFYTSK 1,097.53931 0.30 42.8 4
PSTFMMDYLADK 1,433.62067 0.41 50.9 1
ENPGCLFIATNR 1,381.62956 0.44 83.3 21
TLLVLSGVTSISMLESPENK 2,149.11874 0.53 92.2 10
PSTFMMDYLADK 1,449.61558 0.34 75.1 4
DAVTHLTDAQEWAGGGSMVGALVGSTQR 2,829.33508 0.45 126.7 3
LIEGVPETLDMLR 1,484.79082 0.51 38.4 2
IQYGTLCIR 1,113.54881 0.42 48.9 12
RLVFVTNNSTK 1,277.70914 0.25 68.5 18
LVFVTNNSTK 1,121.60803 0.29 62.2 51
VYVIGEEGILK 1,218.68591 0.41 90.6 25
LIEGVPETLDMLR 1,500.78574 0.45 72.7 10
ELELAGFQYLGGPDDGKR 1,963.96387 0.45 122.8 15
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 2.84 0 97.16 269 STR