last update : january 2015

Public data retrieved in 2014



Home

AT5G35630 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT5G35630
Master Protein AT5G35630.1
Description (curated) GS2 (GLUTAMINE SYNTHETASE 2); glutamate-ammonia ligase
Calculated MW (PPDB) 47.41
Calculated PI (PPDB) 6.42
Length 430
Curated Annotation
Description (curated) GSLI (GLNA2, GS2) Glutamine synthetase, glutamate-ammonia ligase, chloroplast precursor (EC 6.3.1.2) /
Function (curated) metabolism carbon
Localization (curated) Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
WNYDGSSTGQAPGEDSEVILYPQAIFR 2,999.39365 0.56 102.4 11
KAILNLSLR 1,026.65492 0.33 65.2 24
VSGEVPWFGIEQEYTLLQQNVK 2,563.29576 0.61 138.1 29
PIEGDWNGAGCHTNYSTK 1,996.82207 0.31 104.4 4
HETASIDQFSWGVANR 1,816.84921 0.39 136.7 20
EEGGFEVIKK 1,134.59201 0.25 46.2 10
SMREEGGFEVIK 1,396.66559 0.28 44.7 6
GGNNILVICDTWTPAGEPIPTNKR 2,565.30089 0.52 57.8 2
VGRDTEAK 874.45081 0.04 38.6 2
RPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQK 3,873.97095 0.69 120.7 2
AKAAEIFSNKK 1,205.67676 0.16 82.3 12
LTGKHETASIDQFSWGVANR 2,216.09737 0.39 55.1 2
SMREEGGFEVIKK 1,524.76054 0.23 56.8 19
EEGGFEVIK 1,006.49706 0.32 51.4 15
ITEQAGVVLTLDPK 1,482.82932 0.40 121.5 18
HKEHISAYGEGNER 1,625.75456 0.14 102.4 48
VETLLNLDTKPYSDR 1,762.91010 0.38 111.1 93
IIAEYIWIGGSGIDLR 1,774.96170 0.57 99.4 21
RPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQK 3,857.97603 0.70 48.2 2
AAEIFSNKK 1,006.54469 0.18 49.3 30
SMREEGGFEVIKK 1,540.75546 0.22 73.9 107
ITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTK 3,413.65608 0.46 40.7 2
AAEIFSNK 878.44974 0.24 71.4 43
HKEHISAYGEGNERR 1,781.85567 0.12 33.9 1
GKGYLEDR 936.46645 0.18 56.6 6
TIEKPVEDPSELPK 1,580.82971 0.27 67.3 138
GGNNILVICDTWTPAGEPIPTNKR 2,613.28563 0.47 114.3 1
DISDAHYK 947.43484 0.17 42.1 13
EHISAYGEGNER 1,360.60069 0.19 84.1 13
SMREEGGFEVIK 1,412.66051 0.27 72.9 33
VGRDTEAKGK 1,059.56722 0.04 32.3 1
VETLLNLDTK 1,144.63393 0.38 70 8
AKAAEIFSNK 1,077.58180 0.19 61.7 4
RPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQK 3,841.98111 0.72 93.3 2
AILNLSLR 898.55997 0.40 62 61
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 11.57 0.59 87.84 786 STR
Reference of the experiment Reference date Sample CAM Binding Protein
cam_bp 2013-01-01 00:00:00 CET Arabidopsis_stroma;
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 0.276 0.67813 -