last update : january 2015

Public data retrieved in 2014



Home

AT5G35630 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT5G35630
Master Protein AT5G35630.1
Description (curated) GS2 (GLUTAMINE SYNTHETASE 2); glutamate-ammonia ligase
Calculated MW (PPDB) 47.41
Calculated PI (PPDB) 6.42
Length 430
Curated Annotation
Description (curated) GSLI (GLNA2, GS2) Glutamine synthetase, glutamate-ammonia ligase, chloroplast precursor (EC 6.3.1.2) /
Function (curated) metabolism carbon
Localization (curated) Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
VGRDTEAK 874.45081 0.04 38.6 2
SMREEGGFEVIKK 1,524.76054 0.23 56.8 19
AKAAEIFSNK 1,077.58180 0.19 61.7 4
AILNLSLR 898.55997 0.40 62 61
AAEIFSNK 878.44974 0.24 71.4 43
HETASIDQFSWGVANR 1,816.84921 0.39 136.7 20
SMREEGGFEVIKK 1,540.75546 0.22 73.9 107
VETLLNLDTKPYSDR 1,762.91010 0.38 111.1 93
VGRDTEAKGK 1,059.56722 0.04 32.3 1
HKEHISAYGEGNER 1,625.75456 0.14 102.4 48
EEGGFEVIK 1,006.49706 0.32 51.4 15
LTGKHETASIDQFSWGVANR 2,216.09737 0.39 55.1 2
GGNNILVICDTWTPAGEPIPTNKR 2,613.28563 0.47 114.3 1
GGNNILVICDTWTPAGEPIPTNKR 2,565.30089 0.52 57.8 2
GKGYLEDR 936.46645 0.18 56.6 6
SMREEGGFEVIK 1,412.66051 0.27 72.9 33
RPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQK 3,841.98111 0.72 93.3 2
RPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQK 3,857.97603 0.70 48.2 2
EHISAYGEGNER 1,360.60069 0.19 84.1 13
SMREEGGFEVIK 1,396.66559 0.28 44.7 6
VETLLNLDTK 1,144.63393 0.38 70 8
KAILNLSLR 1,026.65492 0.33 65.2 24
PIEGDWNGAGCHTNYSTK 1,996.82207 0.31 104.4 4
IIAEYIWIGGSGIDLR 1,774.96170 0.57 99.4 21
WNYDGSSTGQAPGEDSEVILYPQAIFR 2,999.39365 0.56 102.4 11
DISDAHYK 947.43484 0.17 42.1 13
ITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTK 3,413.65608 0.46 40.7 2
AAEIFSNKK 1,006.54469 0.18 49.3 30
ITEQAGVVLTLDPK 1,482.82932 0.40 121.5 18
EEGGFEVIKK 1,134.59201 0.25 46.2 10
TIEKPVEDPSELPK 1,580.82971 0.27 67.3 138
VSGEVPWFGIEQEYTLLQQNVK 2,563.29576 0.61 138.1 29
HKEHISAYGEGNERR 1,781.85567 0.12 33.9 1
RPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQK 3,873.97095 0.69 120.7 2
AKAAEIFSNKK 1,205.67676 0.16 82.3 12
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 11.57 0.59 87.84 786 STR
Reference of the experiment Reference date Sample CAM Binding Protein
cam_bp 2013-01-01 00:00:00 CET Arabidopsis_stroma;
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST 0.276 0.67813 -