last update : january 2015

Public data retrieved in 2014



Home

AT5G30510 protein group

See also TAIR PPDB AtProteome SUBA POGs Aramemnon
Protein AT5G30510
Master Protein AT5G30510.1
Description (curated) RPS1 (ribosomal protein S1); RNA binding
Calculated MW (PPDB) 45.11
Calculated PI (PPDB) 5.12
Length 416
Curated Annotation
Description (curated) RPS1 30S ribosomal protein S1, chloroplast precursor /
Function (curated) translation stroma
Localization (curated) Ch/S
Localization (validated) Yes
References
Curated Protein Name
Publication (PPDB)
Peptides
Sequence Monoisotopic mass Retention Time Score Observed MS/MS count
GFVPFSQISSK 1,195.62367 0.39 43.3 14
QLQAEDVIVK 1,141.63425 0.30 76.9 78
KMFEDAYER 1,219.51790 0.23 38.4 7
AAAEELLEKEIPLK 1,552.87116 0.41 42.7 1
TSPMEGVAFTVDDFAAAIEQYDFNSEIGTR 3,296.48186 0.69 103.3 3
KLEPTPGDMIR 1,271.65434 0.23 44.2 8
LEPTPGDMIR 1,159.55431 0.27 32.7 3
EIPLKFVEVDEEQTK 1,802.93013 0.37 61.8 4
VMILSHDR 1,001.49640 0.22 57.5 9
IAQAEAMAR 975.48073 0.14 74 9
KLEPTPGDMIR 1,255.65942 0.27 36.3 1
AAAEELLEK 972.51273 0.28 71 14
IAQAEAMAR 959.48581 0.25 45.5 4
VKGTVFK 777.47482 0.15 38.5 3
GTVFKTDANGALVDISAK 1,805.95226 0.35 39.7 1
GGLVALVEGLR 1,082.64471 0.49 88.3 67
VMILSHDR 985.50148 0.22 51 5
SSAYLSVEQACIHR 1,610.73582 0.33 112.7 13
MFEDAYER 1,075.42802 0.27 38 8
AEEMAQTFR 1,081.48621 0.27 46.6 3
TDANGALVDISAK 1,273.65135 0.31 85.3 37
IAQAEAMAR 991.47565 0.14 80.8 48
LVFEKAEEMAQTFR 1,729.83446 0.38 116.1 47
CRQLQAEDVIVK 1,448.72928 0.30 69.8 7
VSDIATVLQPGDTLK 1,555.84570 0.40 117.6 73
VMILSHDRDR 1,272.62445 0.19 46.2 9
KLEPTPGDMIRNPK 1,626.83990 0.20 64.9 3
MFEDAYERCR 1,398.51798 0.25 54.4 5
AEEMAQTFR 1,097.48112 0.20 58.8 18
SSAYLSVEQACIHR 1,562.75108 0.38 54.5 1
VMILSHDR 969.50656 0.21 37.8 1
AEEMAQTFR 1,113.47604 0.20 57.7 63
FVEVDEEQTK 1,222.57170 0.24 74.8 51
GGLVALVEGLRGFVPFSQISSK 2,260.25783 0.66 38.6 1
VIGANKGGLVALVEGLR 1,664.99362 0.45 71.9 2
NIQYELAWER 1,320.64621 0.42 68.4 12
MFEDAYER 1,091.42294 0.26 41.8 14
KLEPTPGDMIR 1,287.64926 0.23 70.7 64
Reference of the experiment Reference date score % of enveloppe score % of thylakoïd score % of stroma Total spectral count Localization Score
at_chloro_v1 2010 06 8.79 1.81 89.39 683 STR
Reference of the experiment Reference date Sample CAM Binding Protein
cam_bp 2013-01-01 00:00:00 CET Arabidopsis_stroma;Arabidopsis_membranes;
Reference of the experiment Reference date Log Fold Change pValue Curated Protein Complex Classes Differentially distributed proteins high or medium
thylakoïd_sub_compartments 2013-10-01 00:00:00 CEST -0.04602 1 -